NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28600.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28600.1 Public Mus musculus 17 Glo1 21 106 86 CCDS HistoryNCBI Gene:109801Re-query CCDS DB by CCDS ID:28600.1Re-query CCDS DB by GeneID:109801See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 28600.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000024823 ENSMUSP00000024823 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000024823Link to Ensembl Protein Viewer:ENSMUSP00000024823Re-query CCDS DB by Nucleotide ID:ENSMUST00000024823Re-query CCDS DB by Protein ID:ENSMUSP00000024823
Original member Current member EBI,WTSI ENSMUST00000167624 ENSMUSP00000126586 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000167624Link to Ensembl Protein Viewer:ENSMUSP00000126586Re-query CCDS DB by Nucleotide ID:ENSMUST00000167624Re-query CCDS DB by Protein ID:ENSMUSP00000126586
Original member Current member NCBI NM_001113560.1 NP_001107032.1 Accepted alive Link to Nucleotide Sequence:NM_001113560.1Link to Protein Sequence:NP_001107032.1Re-query CCDS DB by Nucleotide ID:NM_001113560Re-query CCDS DB by Protein ID:NP_001107032Link to BLAST:NP_001107032.1
Original member Current member NCBI NM_025374.3 NP_079650.3 Accepted alive Link to Nucleotide Sequence:NM_025374.3Link to Protein Sequence:NP_079650.3Re-query CCDS DB by Nucleotide ID:NM_025374Re-query CCDS DB by Protein ID:NP_079650Link to BLAST:NP_079650.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001107032.1 184 Q9CPU0 184 100% 0 0
NP_079650.3 184 Q9CPU0 184 100% 0 0

Chromosomal Locations for CCDS 28600.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 30594138 30594226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30596374 30596463 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30597805 30597872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30600039 30600179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30604020 30604102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30612468 30612551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (555 nt):
ATGGCAGAGCCACAGCCGGCGTCCAGTGGCCTCACTGATGAGACCGCTTTCAGCTGCTGCTCCGATCCAG
AC
CCTAGCACCAAGGATTTTCTACTGCAGCAAACGATGCTAAGAATTAAGGATCCTAAGAAGTCCCTGGA
T
TTTTATACGAGGGTTCTTGGACTGACCCTCCTGCAGAAGCTTGACTTCCCTGCTATGAAGTTCTCGCTC
TAC
TTCTTAGCTTATGAGGATAAGAACGATATCCCCAAGGACAAGTCCGAGAAGACAGCATGGACGTTTT
CC
AGAAAAGCCACCCTTGAGCTCACGCACAACTGGGGCACTGAAGATGACGAGACTCAGAGTTACCACAA
C
GGCAACTCGGACCCTCGTGGATTTGGTCACATTGGGATTGCCGTTCCTGATGTCTACAGTGCCTGTAAG
AGA
TTTGAAGAACTAGGTGTCAAGTTTGTGAAGAAGCCTGATGACGGGAAAATGAAAGGACTGGCGTTCA
TT
CAAGACCCTGACGGCTACTGGATTGAGATTCTGAATCCTAACAAAATAGCAACGATTATTTAG


Translation (184 aa):
MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSL
Y
FLAYEDKNDIPKDKSEKTAWTFSRKATLELT
HNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACK
R
FEELGVKFVKKPDD
GKMKGLAFIQDPDGYWIEILNPNKIATII



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser