NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28502.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28502.1 Public Mus musculus 17 Mrps34 23 108 98 CCDS HistoryNCBI Gene:79044Re-query CCDS DB by CCDS ID:28502.1Re-query CCDS DB by GeneID:79044See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28502.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000043907.13 ENSMUSP00000045111.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000043907.13Link to Ensembl Protein Viewer:ENSMUSP00000045111.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000043907Re-query CCDS DB by Protein ID:ENSMUSP00000045111
Original member Current member EBI,WTSI ENSMUST00000154236.1 ENSMUSP00000120985.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000154236.1Link to Ensembl Protein Viewer:ENSMUSP00000120985.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000154236Re-query CCDS DB by Protein ID:ENSMUSP00000120985
Original member Current member NCBI NM_023260.2 NP_075749.1 Accepted alive Link to Nucleotide Sequence:NM_023260.2Link to Protein Sequence:NP_075749.1Re-query CCDS DB by Nucleotide ID:NM_023260Re-query CCDS DB by Protein ID:NP_075749Link to BLAST:NP_075749.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_075749.1 218 Q9JIK9 218 100% 0 0

Chromosomal Locations for CCDS 28502.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 24895168 24895488 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 24895662 24895704 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 24895788 24896080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (657 nt):
ATGGCGCGGAAGAAAGTAAGACCCCGGCTGATCGCTGAGCTGGCTCGCCGCGTGCGCGCCTTGCGCGAGC
AG
CGGAACCAGCCGCGAGATTCGCAGCTCTACGCCCTAGACTACGAGACGCTGACCCGGCCGCACTCCGG
T
CGCCGGCTGCCGGTACGCGCCTGGGCCGACGTGCGTCGCGAGAGCCGCCTCCTACAGCTGCTCGCCCGC
CTC
CCCTTGTTCGGCCTGGGCCGTCTGGTTACCCGCAAGTCCTGGCTGTGGCAGCACGACGAGCCATGCT
AC
TGGCGCCTCACGCGTGTGAGGCCCGACTACACGGCGCAGAACTTGGACCACGGGAGGGCCTGGGGCAT
C
CTGACTTTCAAAGGGAAGAGTGAGGATACGGCTCGGGAAATCGAGCAAGTCATGTACCACGATTGGCGT
TTG
GTACCCAAGCACGAGGAGGAGGCCTTCACTGCGTTCACTGCGAAACCAGAGGACAGATTGAATTCTG
TC
CCCTATCCACCTCTGCTGCGAGCCATGATCCTCGCTGAACGGCAGAAAAACGGGGATACCAGCGTCCA
G
GAGCCGCTCCTGAACCTGGAGAGGACTCGAATGCGCCCCTGGGACTACCCTGCAAAACAGGAGACGAAA
GGG
AGGGCCAAGGGCACCCCAGTCTAA


Translation (218 aa):
MARKKVRPRLIAELARRVRALREQRNQPRDSQLYALDYETLTRPHSGRRLPVRAWADVRRESRLLQLLAR
L
PLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQ
NLDHGRAWGILTFKGKSEDTAREIEQVMYHDWR
L
VPKHEEEAFTAFTAKPEDRLNSVPYPPLLRAMILAERQKNGDTSVQEPLLNLERTRMRPWDYPAKQETK
G
RAKGTPV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser