NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28167.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28167.1 Public Mus musculus 16 Adprh 23 108 98 CCDS HistoryNCBI Gene:11544Re-query CCDS DB by CCDS ID:28167.1Re-query CCDS DB by GeneID:11544See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28167.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000002923.9 ENSMUSP00000002923.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000002923.9Link to Ensembl Protein Viewer:ENSMUSP00000002923.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000002923Re-query CCDS DB by Protein ID:ENSMUSP00000002923
Original member Current member NCBI NM_007414.3 NP_031440.1 Accepted alive Link to Nucleotide Sequence:NM_007414.3Link to Protein Sequence:NP_031440.1Re-query CCDS DB by Nucleotide ID:NM_007414Re-query CCDS DB by Protein ID:NP_031440Link to BLAST:NP_031440.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031440.1 362 P54923 362 100% 0 0

Chromosomal Locations for CCDS 28167.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 38445690 38446104 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 38447248 38447608 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 38450129 38450441 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1089 nt):
ATGGGTGGGGGGCTGATTGAGAGGTATGTGGCTGCCATGGTGCTGAGCGCGGCTGGAGATACCTTGGGCT
AC
TTCAACGGGAAGTGGGAGTTCATTCGGGATGGGGAGACGATACACCAGCAGTTGGCCCAGATGGGTGA
C
TTGGAAGCCATAGATGTGGCACGATGGAGAGTCAGTGATGATACCGTCATGCACCTGGCCACAGCGGAG
GCC
CTCATGGAAGCCGGCCAGTCCCCGGATTTGCCTCGGCTGTATTCCCTACTAGCCAAACATTACCGGG
AC
TGCATGGGAGACATGGATGGCCGGGCACCAGGTGGTGCTTGCATGCAGAACGCCATGCTGCTACAGCC
C
AACAGGGCCGACGGCTATAGGATTCCCTTCAACAGTCACGAGGGTGGCTGCGGGGCTGCCATGCGCGCC
ATG
TGCATCGGGCTGAGGTTCCCCCACCCCAGCCAACTGGATCTGCTGATCCAAGTGAGCATCGAGAGCG
GC
CGGATGACCCACCACCACCCCACGGGCTACCTCGGCAGCCTTGCGTCCGCTCTTTTTACGGCATATGC
C
GTGAATGGCAAGTCACCATGGCAGTGGGGAAAAGGGCTAATGGAGGTGCTGCCTGAAGCCAAAAAGTAC
ATC
ACTCAGTCAGGCTACTTTGTGAAGGAGAATCTTCAACACTGGTCCTACTTCGAGAAAGAATGGGAAA
AG
TACCTGGAGCTTAGAGGAATTTTGGACGGCAACTCGGCTCCCGTCTTCCCGCAGCCCTTTGGTGTGAA
G
GAAAGGGATCAGTTCTACATCGACGTGAGCTACTCGGGCTGGGGTGGCAGCAGCGGACACGATGCCCCC
ATG
ATTGCCTACGATGCCCTCCTGGCCGCGGGGGATTCCTGGAAGGAGCTCGCACACAGAGCCTTCTTCC
AC
GGTGGAGACAGTGATTCCACGGCCGCCATTGCTGGCTGCTGGTGGGGAGTTATGTACGGCTTTAAAGG
C
GTAAATCCCGCCAACTACGAGAAGCTCGAATACCGACAGCGGCTAGAAGAGGCCGGAAGAGCTTTGTAT
TCT
CTCGGGTCAAAAGAAGACCCTGTATTAGATCCCTAG


Translation (362 aa):
MGGGLIERYVAAMVLSAAGDTLGYFNGKWEFIRDGETIHQQLAQMGDLEAIDVARWRVSDDTVMHLATAE
A
LMEAGQSPDLPRLYSLLAKHYRDCMGDMDGRAP
GGACMQNAMLLQPNRADGYRIPFNSHEGGCGAAMRA
M
CIGLRFPHPSQLDLLIQVSIESGRMTHHHPTGYLGSLASALFTAYAVNGKSPWQWGKGLMEVLPEAKKY
I
TQSGYFVKENLQH
WSYFEKEWEKYLELRGILDGNSAPVFPQPFGVKERDQFYIDVSYSGWGGSSGHDAP
M
IAYDALLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVNPANYEKLEYRQRLEEAGRALY
S
LGSKEDPVLDP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser