NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28046.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28046.1 Public Mus musculus 16 Abcc5 23 108 98 CCDS HistoryNCBI Gene:27416Re-query CCDS DB by CCDS ID:28046.1Re-query CCDS DB by GeneID:27416See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28046.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000096199.4 ENSMUSP00000093913.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000096199.4Link to Ensembl Protein Viewer:ENSMUSP00000093913.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000096199Re-query CCDS DB by Protein ID:ENSMUSP00000093913
Original member Current member NCBI NM_176839.1 NP_789809.1 Accepted alive Link to Nucleotide Sequence:NM_176839.1Link to Protein Sequence:NP_789809.1Re-query CCDS DB by Nucleotide ID:NM_176839Re-query CCDS DB by Protein ID:NP_789809Link to BLAST:NP_789809.1

Chromosomal Locations for CCDS 28046.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 20402299 20402334 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20404566 20404713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20405389 20405544 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20405727 20405884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20422305 20422433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (627 nt):
ATGAAAGATATTGACATGGGAAAAGAATATATCATCCCCAGCCCTGGGTACAGAAGTGACAGGGACAGAA
GC
GCTGTACCAGGGCAACACAGAGACCCCGAGGAACCCAGGTTCCGGAGAACAAGATCGTTGGAATGCCA
A
GATGCTCTCGAAACAGCAGCCCGAGTTGAGGGGCTTTCCCTGGATATCTCTGTGCATTCTCATCTCCAA
ATT
CTGGACGAGGAGCATTCTAAGGGAAAATACCACCATGGTTTAAGTGTCCTGAAGCCCTTCCGGACCA
CT
ACCAAGCACCAGCACCCAGTGGACAATGCTGGACTTTTCTCCTACATGACCTTTTCATGGCTCTCTCC
T
CTGGCCCGAGTGGTTCACAAGAAGGGGGAGCTGTTAATGGAGGATGTGTGGCCTTTGTCCAAGTATGAG
TCT
TCTGATGTGAACAGCAGAAGACTAGAGAGACTGTGGCAAGAAGAGCTGAATGAAGTTGGGCCAGACG
CT
GCCTCCCTGCGAAGGGTTGTGTGGATCTTTTGCCGCACCAGGCTCATCCTGTCCATCGTGTGCCTGAT
G
ATCACGCAGTTGGCTGGCTTCAGTGGACCAAATTTTCAGGATGGCTGTATTCTGCGGTCAGAATGA


Translation (208 aa):
MKDIDMGKEYIIPSPGYRSDRDRSAVPGQHRDPEEPRFRRTRSLECQDALETAARVEGLSLDISVHSHLQ
I
LDEEHSKGKYHHGLSVLKPFRTTT
KHQHPVDNAGLFSYMTFSWLSPLARVVHKKGELLMEDVWPLSKYE
S
SDVNSR
RLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPNFQDGCILRSE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser