NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28045.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28045.1 Public Mus musculus 16 Abcc5 23 108 98 CCDS HistoryNCBI Gene:27416Re-query CCDS DB by CCDS ID:28045.1Re-query CCDS DB by GeneID:27416See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28045.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000079158.12 ENSMUSP00000078158.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000079158.12Link to Ensembl Protein Viewer:ENSMUSP00000078158.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000079158Re-query CCDS DB by Protein ID:ENSMUSP00000078158
Original member Current member EBI ENSMUST00000115547.8 ENSMUSP00000111209.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115547.8Link to Ensembl Protein Viewer:ENSMUSP00000111209.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000115547Re-query CCDS DB by Protein ID:ENSMUSP00000111209
Original member Current member NCBI NM_013790.2 NP_038818.2 Accepted alive Link to Nucleotide Sequence:NM_013790.2Link to Protein Sequence:NP_038818.2Re-query CCDS DB by Nucleotide ID:NM_013790Re-query CCDS DB by Protein ID:NP_038818Link to BLAST:NP_038818.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038818.2 1436 Q9R1X5 1436 100% 0 0

Chromosomal Locations for CCDS 28045.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 20332604 20332705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20333586 20333750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20335106 20335219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20338876 20338954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20344635 20344794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20357369 20357558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20362182 20362271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20363975 20364161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20365605 20365733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20365813 20365966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20368042 20368171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20368424 20368570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20369026 20369210 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20372120 20372219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20374991 20375134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20376511 20376714 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20378447 20378519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20378642 20378766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20389369 20389440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20392451 20392807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20396015 20396122 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20396980 20397128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20398813 20398960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20399475 20399648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20399806 20400039 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20404566 20404713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20405389 20405544 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20405727 20405884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20422305 20422433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4311 nt):
ATGAAAGATATTGACATGGGAAAAGAATATATCATCCCCAGCCCTGGGTACAGAAGTGACAGGGACAGAA
GC
GCTGTACCAGGGCAACACAGAGACCCCGAGGAACCCAGGTTCCGGAGAACAAGATCGTTGGAATGCCA
A
GATGCTCTCGAAACAGCAGCCCGAGTTGAGGGGCTTTCCCTGGATATCTCTGTGCATTCTCATCTCCAA
ATT
CTGGACGAGGAGCATTCTAAGGGAAAATACCACCATGGTTTAAGTGTCCTGAAGCCCTTCCGGACCA
CT
ACCAAGCACCAGCACCCAGTGGACAATGCTGGACTTTTCTCCTACATGACCTTTTCATGGCTCTCTCC
T
CTGGCCCGAGTGGTTCACAAGAAGGGGGAGCTGTTAATGGAGGATGTGTGGCCTTTGTCCAAGTATGAG
TCT
TCTGATGTGAACAGCAGAAGACTAGAGAGACTGTGGCAAGAAGAGCTGAATGAAGTTGGGCCAGACG
CT
GCCTCCCTGCGAAGGGTTGTGTGGATCTTTTGCCGCACCAGGCTCATCCTGTCCATCGTGTGCCTGAT
G
ATCACGCAGTTGGCTGGCTTCAGTGGACCAGCCTTCGTGGTGAAGCACCTCTTGGAGTACACCCAGGCA
ACA
GAGTCTAACCTGCAGTACAGCTTGCTGTTAGTGTTAGGCCTACTCCTGACAGAAGTTGTACGCTCCT
GG
TCACTTGCACTGACTTGGGCATTGAATTATCGAACTGGTGTCCGGTTGCGGGGGGCTATCCTGACTAT
G
GCATTCAAGAAGATCCTGAAGTTAAAGAACATTAAAGAAAAGTCCCTAGGGGAGCTCATCAATATCTGC
TCC
AATGATGGGCAAAGGATGTTTGAGGCAGCCGCTGTGGGCAGCTTGCTGGCTGGAGGACCTGTTGTTG
CC
ATCTTGGGCATGATTTATAATGTAATCATCCTAGGACCCACGGGCTTCCTGGGATCAGCGGTTTTTAT
C
CTCTTTTATCCAGCAATGATGTTCGTGTCACGGCTAACTGCATATTTCAGGAGAAAGTGTGTAGCTGCC
ACA
GATGACCGTGTCCAGAAGATGAATGAAGTTCTTACCTACATTAAATTCATTAAAATGTATGCCTGGG
TC
AAAGCGTTTTCTCAGTGTGTGCAAAAAATCCGAGAGGAGGAACGTCGGATATTGGAGAAAGCCGGGTA
C
TTTCAGAGCATCACTGTTGGAGTGGCTCCTATTGTGGTAGTGATCGCCAGTGTGGTGACGTTCTCCGTT
CAC
ATGACCCTGGGCTTCCATCTGACTGCGGCACAGGCCTTCACAGTGGTGACTGTCTTCAATTCCATGA
CT
TTTGCTTTAAAAGTAACACCATTCTCAGTGAAGTCCCTCTCTGAAGCATCAGTGGCTGTTGACAGATT
T
AAGAGTTTGTTTCTAATGGAAGAGGTTCACATGATAAAGAACAAACCGGCCAGTCCTCACATCAAGATA
GAG
ATGAAAAATGCCACCTTGGCATGGGACTCCTCCCACTCCAGTATACAGAACTCGCCCAAGCTGACCC
CC
AAAATGAAAAAAGACAAGAGGGCTACCAGGGGCAAGAAAGAGAAGTCGAGGCAGCTGCAACACACTGA
G
CACCAGGCGGTGCTGGCAGAACAGAAAGGACACCTCCTCCTGGACAGTGACGAGCGGCCCAGCCCGGAA
GAG
GAAGAAGGCAAGCAGATCCACACAGGGAGCCTGCGCCTGCAGAGGACACTGTACAACATTGACTTAG
AA
ATTGAAGAGGGCAAACTGGTTGGAATCTGCGGCAGTGTGGGAAGTGGAAAAACCTCTCTCGTTTCAGC
C
ATTTTAGGCCAGATGACGCTTTTGGAGGGCAGCATTGCCGTCAGTGGGACCTTTGCTTATGTGGCCCAA
CAG
GCCTGGATTCTCAATGCCACTCTGAGAGACAACATTCTCTTTGGGAAGGAATTTGATGAAGAGAGAT
AC
AACTCAGTGCTGAATAGCTGCTGCCTGCGGCCTGACTTGGCCATTCTCCCCAACAGCGACCTGACTGA
G
ATTGGAGAGCGAGGAGCCAACCTGAGTGGTGGACAGCGCCAGAGAATCAGCCTTGCTAGAGCCTTGTAC
AGT
GATAGAAGCATCTACATCCTGGATGACCCCCTCAGTGCCTTAGATGCCCATGTGGGCAACCACATCT
TC
AACAGTGCTATCCGGAAGCGCCTCAAGTCTAAGACGGTTCTGTTTGTTACACACCAGTTACAGTATCT
G
GTCGATTGTGATGAGGTGATCTTCATGAAGGAAGGCTGTATCACAGAGAGAGGTACCCATGAGGAGCTG
ATG
AACTTAAATGGGGATTACGCTACGATTTTTAATAACCTGTTGCTGGGAGAGACACCCCCAGTTGAGA
TT
AATTCGAAAAAGGAAGCTACTGGTTCACAAAAATCACAAGACAAGGGCCCTAAGCCAGGGTCAGTGAA
G
AAGGAGAAGGCGGTGAAGTCGGAGGAAGGGCAGCTTGTGCAGGTGGAGGAGAAAGGGCAAGGTTCTGTG
CCT
TGGTCAGTCTACTGGGTCTACATCCAGGCTGCAGGGGGCCCCTTGGCTTTCCTGGTCATCATGGTCC
TC
TTCATGCTGAATGTGGGCAGCACTGCCTTCAGCACCTGGTGGCTTAGCTACTGGATCAAGCAAGGAAG
C
GGGAACAGCACAGTGTATCAAGGGAACAGAAGCTTCGTGAGTGACAGCATGAAGGACAACCCCTTCATG
CAG
TACTACGCCAGCATCTACGCCCTCTCCATGGCAGTCATGCTGATCTTGAAAGCCATTCGAGGAGTTG
TC
TTCGTCAAGGGCACACTGAGAGCCTCCTCCCGGCTCCATGATGAGCTATTCCGAAGGATCCTTAGGAG
C
CCCATGAAGTTTTTTGATACTACCCCAACAGGAAGGATTCTCAACAGGTTTTCCAAAGACATGGATGAA
G
TG
GATGTGCGGCTGCCGTTCCAGGCTGAGATGTTTATTCAGAATGTAATCCTGGTGTTCTTCTGTGTTG
GA
ATGATTGCTGGAGTCTTCCCATGGTTCCTCGTGGCGGTGGGGCCTCTCCTCATCCTCTTCTCACTTCT
C
CACATTGTCTCCAGGGTCCTGATTCGTGAGCTAAAGCGGTTGGACAATATCACGCAGTCTCCTTTCCTC
TCC
CACATCACGTCTAGCATTCAGGGCCTGGCCACCATCCATGCCTACAACAAAAGGCAGGAGTTTTTAC
AC
AGGTATCAGGAGCTCCTGGATGACAACCAGGCTCCCTTTTTCCTGTTCACCTGTGCAATGAGGTGGCT
G
GCAGTGCGGCTGGACCTCATCAGCATTGCCCTGATTACCACCACTGGCCTGATGATTGTTCTCATGCAT
GGA
CAGATCCCTTCAGCCTATGCGGGGCTTGCCATCTCCTACGCTGTGCAGTTAACTGGACTATTCCAGT
TC
ACCGTCAGACTGGCATCGGAGACAGAAGCACGGTTCACTTCCGTGGAGAGGATCAACCACTATATCAA
G
ACTCTCTCTTTGGAAGCACCTGCCAGAATCAAGAACAAGGCTCCTCCCCATGACTGGCCCCAGGAGGGA
GAA
GTAACCTTTGAGAATGCAGAAATGAGATACCGGGAAAATCTCCCTCTGGTCCTTAAGAAAGTGTCCT
TC
ACCATCAAGCCCAAGGAAAAGATAGGCATTGTGGGACGAACAGGGTCAGGGAAGTCCTCTTTGGGGAT
G
GCCCTCTTCCGTCTGGTGGAGCTATCTGGAGGCTGCATCAAGATTGATGGAATAAGAATCAGTGACATC
GGC
CTGGCCGACCTCCGAAGCAAACTGGCCATCATTCCTCAGGAGCCAGTGCTGTTCAGTGGCACTGTCA
G
A
TCAAACCTGGACCCTTTCAACCAGTACACGGAAGACCAGATCTGGGATGCTCTAGAGAGAACGCACAT
G
AAGGAATGTATTGCCCAGCTACCTCTGAAACTTGAGTCTGAAGTAATGGAGAACGGGGACAACTTCTCT
GTT
GGGGAACGGCAGCTGTTGTGCATAGCAAGAGCCCTGCTGCGTCACTGTAAGATTCTGATTTTAGATG
AA
GCTACAGCCGCTATGGACACAGAGACAGACTTACTGATCCAGGAGACCATCCGGGAAGCATTTGCGGA
C
TGCACCATGCTGACCATTGCCCATCGCCTGCACACAGTTCTGGGCTCTGACAGGATCATGGTGCTGGCC
CAG
GGACAGGTGGTGGAGTTTGACACCCCATCGGTCCTTCTGTCTAATGACAGTTCAAGATTCTATGCCA
TG
TTTGCTGCTGCAGAGAACAAGGTGGCTGTCAAGGGCTGA


Translation (1436 aa):
MKDIDMGKEYIIPSPGYRSDRDRSAVPGQHRDPEEPRFRRTRSLECQDALETAARVEGLSLDISVHSHLQ
I
LDEEHSKGKYHHGLSVLKPFRTTT
KHQHPVDNAGLFSYMTFSWLSPLARVVHKKGELLMEDVWPLSKYE
S
SDVNSR
RLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFVVKHLLEYTQA
T
ESNLQYSLLLVLGLLLTEVVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGE
LINIC
S
NDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAM
MFVSRLTAYFRRKCVAA
T
DDRVQKMNEVLTYIKFIKMYAWVKAFSQCVQ
KIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSV
H
MTLGFHLTAAQ
AFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKI
E
MKNATLAWDSSHSSIQNSPKLTPKMKKDKRATRGKKEKSRQLQHTEHQAVLAEQKGHLLLDSDERPSPE
E
EEGKQIHTGSLRLQRTLYNIDLEIEE
GKLVGICGSVGSGKTSLVSAILGQMTLLEGSIAVSGTFAYVAQ
Q
AWILNATLRDNILFGKEFDEE
RYNSVLNSCCLRPDLAILPNSDLTEIGERGANLSGGQRQRISLARALY
S
DRSIYILDDPLSALDAHVGNHIFNSAIRKRLKSKTVLFVTHQLQ
YLVDCDEVIFMKEGCITERGTHEEL
M
NLNGDYATIFNNLLLGETPPVE
INSKKEATGSQKSQDKGPKPGSVKKEKAVKSEEGQLVQVEEKGQGSV
P
WSVYWVYIQAAGGPLAFLVIMVLFMLNVGSTAFSTWWLSYWIKQGSG
NSTVYQGNRSFVSDSMKDNPFM
Q
YYASIYALSMAVMLILKAIRGVVFVK
GTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDE
V
DVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLLILFSLLHIVSRVLIRELKRLDNITQSPFL
S
HITSSIQGLATIHAYNKRQEFLH
RYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMH
G
QIPSAYAGLAISYAVQ
LTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPPHDWPQEG
E
VTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGS
GKSSLGMALFRLVELSGGCIKIDGIRISDI
G
LADLRSKLAIIPQEPVLFSGTV
RSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNFS
V
GERQLLCIARALLRHCK
ILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLA
Q
GQ
VVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser