NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, October 16, 2019, starting at 8:00 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27988.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27988.1 Public Mus musculus 16 Spag6l 21 106 86 CCDS HistoryNCBI Gene:50525Re-query CCDS DB by CCDS ID:27988.1Re-query CCDS DB by GeneID:50525See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27988.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023468 ENSMUSP00000023468 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023468Link to Ensembl Protein Viewer:ENSMUSP00000023468Re-query CCDS DB by Nucleotide ID:ENSMUST00000023468Re-query CCDS DB by Protein ID:ENSMUSP00000023468
Original member Current member EBI,WTSI OTTMUST00000063093 OTTMUSP00000031166 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000063093Link to Vega Protein Viewer:OTTMUSP00000031166Re-query CCDS DB by Nucleotide ID:OTTMUST00000063093Re-query CCDS DB by Protein ID:OTTMUSP00000031166
Original member Current member NCBI NM_015773.2 NP_056588.1 Accepted alive Link to Nucleotide Sequence:NM_015773.2Link to Protein Sequence:NP_056588.1Re-query CCDS DB by Nucleotide ID:NM_015773Re-query CCDS DB by Protein ID:NP_056588Link to BLAST:NP_056588.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_056588.1 507 Q9JLI7 507 100% 0 0

Chromosomal Locations for CCDS 27988.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 16753814 16753877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16763022 16763167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16766969 16767085 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16777323 16777514 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16780621 16780773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16781745 16781918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16783735 16783940 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16787215 16787398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16792497 16792663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16829020 16829115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16829195 16829219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1524 nt):
ATGAGCCAGCGGCAGGTGCTGCAAGTGTTCGAGCAGTACCAGAAAGCCCGGACGCAATTCGTGCAGATGG
TG
GCAGAGCTGGCGACAAGACCCCAAAACATCGAAACGCTGCAGAATGCAGGTGTAATGTCTTTGCTAAG
G
CCGCTTCTTCTGGATGTGGTCCCAACAATTCAACAGACTGCAGCTTTGGCTCTGGGGAGACTGGCCAAT
TAC
AATGATGACTTAGCAGAAGCAGTCGTGAAAGGTGACATTCTTCCACAGCTTGTTTATTCATTGGCAG
AA
CAAAATCGTTTTTACAAGAAGGCAGCTGCCTTTGTGTTGAGAGCAGTTGGGAAACACTCTCCTCAGCT
G
GCCCAGGCCATAGTTGACTGCGGAGCTCTGGATACACTGGTGATCTGCTTGGAGGATTTTGACCCTGGG
GTC
AAGGAGGCTGCAGCCTGGGCACTCGGATACATTGCAAGACACAACACAGAATTATCTCAAGCCGTGG
TG
GATGCAGGAGCAATTCCTCTTTTAGTCCTTTGTATCCAGGAGCCAGAAATTGCTTTGAAAAGGATCGC
T
GCCTCGGCCCTCAGTGATATCTCAAAGCACTCCCCAGAGTTAGCACAGACGGTGGTGGACGCAGGAGCT
ATT
GCTCACTTAGCCCAGATGATCCTCAACCCTGATGCAAAACTGAAGCGCCAGGTCCTCTCAGCTCTCA
GT
CAGATTGCAAAGCATTCTGTGGACTTGGCAGAGATGGTTGTTGAAGCAGAGATTTTCCCTGTTGTACT
A
ACCTGCCTGAAGGACAAAGATGAATATGTGAAGAAAAATGCTTGCACCTTAATCAGAGAGATTGCAAAA
CAC
ACGCCTGAGCTCTCGCAGCTGATTGTTAATGCAGGAGGCGTGGCTGCCGTGATCGATTGCATTGGGT
CC
TGCAAAGGGAACATACGGCTGCCTGGCATCATGATGCTGGGTTACGTGGCTGCTCATTCTGAGAACCT
G
GCCATGGCGGTGATCATCTCCAAGGGTGTACCCCAGTTGTCAATCTGCCTGTCAGAAGAACCAGAAGAT
CAT
ATTAAGGCTGCTGCTGCCTGGGCCTTGGGGCAGCTGGGAAGACACACTCCAGAGCATGCCAGGGCTG
TG
GCTGTCACAAACACGCTGCCAGTCCTGCTGTCTTTGTACATGTCACCAGAGAGCTCTGAGGACCTACA
G
CTCAAAAGTAAAAAAGCCATAAAGAATATCCTTCAGAAATGCACCTACCTCCCAGCCCTTGAGCCGTTC
CTG
TACGACGCACCTCCCAATATCCTGAAACATGTTGTTGGGCAGTTCAGTAAGGTGCTGCCACATGACA
GC
AAAGCCCGGCGGCTTTTCGTGACTAGTGGTGGACTTAAAAAGGTTCAGGAGATAAAGGCAGAACCAGG
C
TCTCTCCTGCAGGAATACATCAACAGCATCAACAATTGTTACCCAGAGGAAATAGTAAGGTATTATTCA
CCT
GGATACTCCGATACACTTCTGCAGAGGGTGGACAGCTACCAACCACTGTGA


Translation (507 aa):
MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRPLLLDVVPTIQQTAALALGRLAN
Y
NDDLAEAVVKGDILPQLVYSLAEQN
RFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPG
V
KEAAAWALGYIARHNT
ELSQAVVDAGAIPLLVLCIQEPEIALKRIAASALSDISKHSPELAQTVVDAGA
I
AHLAQMILNPDAKLK
RQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNACTLIREIAK
H
TPE
LSQLIVNAGGVAAVIDCIGSCKGNIRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSICLSEEPED
H
IKAAAAWALGQLGRHTPEHARAVAVTNTLPVLLSLYMSPESSEDLQLK
SKKAIKNILQKCTYLPALEPF
L
YDAPPNILKHVVGQFSK
VLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINNCYPEEIVRYYS
P
GYSDTLLQRVDSYQPL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser