NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27878.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27878.1 Public Mus musculus 15 Espl1 23 108 98 CCDS HistoryNCBI Gene:105988Re-query CCDS DB by CCDS ID:27878.1Re-query CCDS DB by GeneID:105988See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27878.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000064924.5 ENSMUSP00000064465.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000064924.5Link to Ensembl Protein Viewer:ENSMUSP00000064465.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000064924Re-query CCDS DB by Protein ID:ENSMUSP00000064465
Original member Current member EBI,WTSI ENSMUST00000229050.1 ENSMUSP00000155304.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000229050.1Link to Ensembl Protein Viewer:ENSMUSP00000155304.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000229050Re-query CCDS DB by Protein ID:ENSMUSP00000155304
Original member Current member NCBI NM_001014976.2 NP_001014976.1 Accepted alive Link to Nucleotide Sequence:NM_001014976.2Link to Protein Sequence:NP_001014976.1Re-query CCDS DB by Nucleotide ID:NM_001014976Re-query CCDS DB by Protein ID:NP_001014976Link to BLAST:NP_001014976.1
Original member Current member NCBI NM_001356312.1 NP_001343241.1 Accepted alive Link to Nucleotide Sequence:NM_001356312.1Link to Protein Sequence:NP_001343241.1Re-query CCDS DB by Nucleotide ID:NM_001356312Re-query CCDS DB by Protein ID:NP_001343241Link to BLAST:NP_001343241.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001014976.1 2118 P60330 2118 100% 0 0
NP_001343241.1 2118 P60330 2118 100% 0 0

Chromosomal Locations for CCDS 27878.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 102296769 102296849 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102298184 102299239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102299419 102299523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102299803 102299914 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102302612 102302748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102303952 102304145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102304926 102305165 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102305665 102305809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102305898 102306036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102306235 102306374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102309198 102309332 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102310600 102310719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102312415 102312586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102312936 102313064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102313183 102313339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102313987 102314096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102315188 102316176 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102316519 102316891 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102317050 102317211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102319412 102319625 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102319703 102319893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102320413 102320540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102320644 102320766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102322325 102322480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102322576 102322746 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102322868 102322972 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102323155 102323270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102323450 102323533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102323643 102323807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102324008 102324215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6357 nt):
ATGAGGAACTTCAAAGGAGTCAACTTCGCCACTCTGCTCTGCAGCAAGGAGGAGACCCAGCAGCTGCTGC
CT
GACTTGAAGGAGTTCCTGTCCAGATCCCGGACTGATTTCCCCAGCAGCCGAACAGATGCCGAAAGAAG
A
CAAATTTGCGATACCATCCTGAGGGCTTGCACCCAGCAGTTGACTGCCAAGCTCGATTGCCCTGGGCAC
CTG
AGGAGTATTTTGGACCTGGCAGAGCTGGCCTGTGATGGCTATTTGTTGTCTACTCCACAGCGCCCTC
CC
CTCTACCTGGAACGCATTCTCTTCATCCTACTTCGCAATGGTTCCACTCAGGGAAGCCCAGACACTGT
G
CTGCGCCTTGCCCAGCCTCTCCATGCCTGCTTGGTTCAGAACTCTGGAGAGGCTGCCCCTCAGGACTAT
GAG
GCCGTGACCCGGGGCAGCTTCTCTCTGTTTTGGAAGGGAGCAGAGGCACTGTTGGAGCGGCGAGCTG
CG
TTCTCAACTCGGCTGAATGCCTTGAGCTTCTTGGTGCTCTTGGAGGATGGCAGTGTCCCCTGTGAGGT
C
CCTCACTTTGCTTCTCCAACCGCCTGTCGTTTAGTTGCCGCCTATCAGCTGTACGATGCTACAGGACAA
GGT
CTAGATGAAGCTGATGCCGACTTCCTGTATGAAGTGCTTTCTAGGCACCTGATCAGAGTCTTAGTAG
GT
GAGGGTGGTAGCTCTCCCGGTCCTCTCTCGCCTCAGAGGGCCCTCTGCCTCTTGGAAATCACCCTGGA
A
CACTGCCGTCGGCTCTGCTGGAACCACCACCACCGCCAGGCTGCCAGAGCAGTGGAGAGGGCTCGTAAT
CAC
CTAGAGAAGACCAGTGTAGCTCCTAGCCTCCAGTTATGCCAGATGGGGGTTGAGCTGTTGGAAGCTG
TA
GAAGAAAGACCAGGGGCAGTGGCCCAGCTTCTGAGGAAGGCAGCAGCCGTTCTTATCAACAGTATCGA
G
GCGCCGTCGCCCCCGCTCCGGGCATTGTACGACAGCTGCCAGTTCTTCCTTTCAGGCCTGGAGAGAGGC
ATC
AGGAGGCACTGTGGACTTGATGCCATATTGAGTCTCTTTGCTTTTCTTGGGGGATACAGCTCCCTTG
TC
CGGCACCTGAGAGAAGTCTCTGAAGCATCTTCCAAGCAGCAGCAGTGCTTGCTTCAGATGCACTTCCA
G
GGTTTCCACCTCTTCACCGGGATTGTGTATGACTTTGCTCAAGGCTGTCAGGCAACTGAGCTTGCTCAG
CTA
GTGGACGGTTGCAGATCTGCTGCTGTCTGGATGTTGGAGGCCTTAGAGGGCCTGTCGGGTGGAGAGC
TG
GCTGACTACCTGAGCATGACTGCCTCTTACACCAGCAACTTGGCCTACAGCTTCTTTAGTCAGAAGCT
C
TATGAGGAGGCCTGCGTCATCTCAGAGCCAGTCTGTCAGCACTTGGGCTCGGCAACGTCGGGTGCTTGT
CCT
GAAGTGCCTCCTGAGAAGCTACATAGGTGCTTCAGGCTGCATGTGGAGAGTTTGAAGAAACTGGGTA
AA
CAGGCCCAGGGCTGCAAGATGGTGACCTTATGGCTGGCAGCTCTGAAACCCTACAGTCTGGAACACAT
G
GTCGAGCCAGTCACTTTCTGGGTTCGAGTCAAAATGGATGCATCCAGGGCAGGAGACAAGGAGCTACAA
CTT
CAGACTTTGCGAGACAGCCTAAGCTGCTGGGACCCAGAGACACAGTCTCTGCTTCTCAGGGAGGAGC
TG
CGGGCCTACAAGTCAGTACGGGCTGACACTGGGCAGGAGCGCTTCAACATCATCTGTGATCTGCTCGA
G
CTGAGCCCTGAAGAGACAGCAGCTGGAGCCTGGGCACGAGCTACCTACCTGGTGGAACTGGCCCAAGTG
CTG
TGCTACCACAACTTTACCCAGCAGACCAACTGCTCTGCCTTGGATGCTGTCCAGGAAGCCCTGCAGC
TT
CTGGAGTCCGTGAGTCCTGAGGCCCAGGAGCAGGATCGACTTCTGGATGATAAAGCACAGGCCTTGTT
A
TGGCTTTACATCTGTACCTTAGAGGCCAAGATGCAGGAAGGTATTGAGCGGGATCGGAGAGCCCAGGCC
CCT
AGTAACTTGGAGGAATTTGAAGTCAATGACCTGAACTATGAAGATAAACTGCAGGAAGATCGTTTTC
TG
TATAGTAGCATTGCCTTCAATCTGGCTGCTGATGCAGCTCAGTCCAAATGCCTGGACCAGGCCCTGAC
T
CTGTGGAAAGAAGTGCTCACCAAGGGGCGAGCCCCAGCTGTGCGGTGTCTCCAGCAGACTGCAGCCTCC
CTG
CAAATCCTAGCGGCCGTCTATCAGTTGGTGGCAAAGCCCTTGCAGGCTCTGGAGACCCTCCTGCTCC
TG
CAGATTGTATCTAAGAGACTGCAGGACCACGCAAAGGCAGCCAGCTCTTCCTGCCAGCTTACCCAGCT
A
CTCTTGAACCTTGGCTGTCCCAGCTATGCGCAGTTGTATCTGGAAGAGGCGGAGTCAAGCCTGAGGAGC
CTG
GACCAGACAAGTGACGCGTGCCAGCTGCTGTCCCTGACCTGTGCTCTGCTTGGAAGTCAGCTCTGCT
GG
GCTTGCCAGAAGGTAACTGCAGGCGTTTCTTTGTTGCTTTCTGTGCTTCGGGATCCTGCCCTCCAGAA
G
TCATCTAAGGCTTGGTACTTGCTACGTGTCCAGGCCCTGCAAGTTCTGGCTTTTTACCTCAGTCTCTCG
TCC
AACCTCCTCTCAAGTGCCCTGCGTGAGCAGCTCTGGGATCAAGGCTGGCAGACCCCGGAGACGGCGC
TG
ATTGATGCCCACAAGCTCCTCAGAAGCATCATCATTCTGCTCATGGGAAGTGATGTGCTCTCCATTCA
G
AAAGCAGCCACCGAGTCGCCCTTTCTGGACTACGGTGAGAATCTGGTGCAAAAATGGCAGGTTCTCACA
GAG
GTGCTGACCTGCTCGGAGAGGCTGGTCGGCCGCCTGGGTCGCCTGGGGAACGTGAGTGAGGCCAAGG
CC
TTTTGCTTGGAGGCCCTAAAACTTACGACTAAGCTGCAGATACCTCGACAGTGTGCCCTGTTCCTTGT
A
CTGAAGGGTGAGCTGGAGCTGGCCCGGGGTGACATTGACCTCTGTCAGTCAGACTTGCAGCAGGTTCTC
TTC
TTGCTCGAGTCTTCCACAGAGTTTGGTGTTGTGACCCAGCATCCAGACTCAGTGAAGAAGGTGCACA
CG
CAGAAAGGGAAGCATAAGGCTCAAGGCCCATGTTTCCCACCCCTGTCAGAGGAGGAGCCCTTCCTGAA
A
GGTCCTGCCCTTGAGCTGGTGGACACTGTGCTCAACGAACCTGGTCCCATCCAGTCCTCTGTAAACTCC
TCC
CCAGTCCTGAAAACCAAGCCACCACCCAACCCTGGCTTCCTGTCTCACTTGCCCAGCTGTGACTGCT
TA
CTGTGTGCCAGCCCTGCCCTCTCAGCAGTCTGTCTGCGCTGGGTGCTGGTCACTGCCGGAGTGAGGCT
G
GCCACCGGTCACAAAGCTCAGGGTCTGGATCTGCTGCAAGCTGTGCTGACGCGTTGCCCTGCAGCCACC
AAG
CGCTTCACACAGAGTCTCCAAGCTTCTCTGAATCACAGAACAACCCCCTCTTGTGTTCCCAGCCTCT
TT
GATGAGATCATGGCTCAAGTGTACACGCACTTGGCATTGGAGTTCCTGAATCAGACATCTGAAAAGAG
C
CTGGGGAAGGTCCTGGCGTCGGGGCTGAAGTTTGTGGCAACACGGATACAGAGCTTGGAGATCTGGAGA
GCC
CACCTGCTCTTGGTTCAGGCCCTTGCAAAGCTGGCCCACTTCAGCTGCTGTACTTCCGAACTCTTTG
CA
AGCTCCTGGGGCTGGCACCCACCATTAGTAAAAAGTCTGCCAGTCTTAGAGCCTGCTAAAATTCGGAG
A
CAAAAATGCTCTGGACGGGGCCGCCGGCGGATAGCCTCTGTTCCCCCACCCCTCCATAACAGCTCTCAG
AAA
GGTCTGGAAGAGGAAGGGCCACCTTGTACCCCTAAGCCTCCAGGTCGGGCTAGGCAAGCTGGCCCTC
GT
GTCCCTTTCACCATATTTGAAGAAGTCCACCCCACCAAGAGCAAGCTCCAGGTTCCCTTGGCTCCCAG
G
GTCCACAGGCGGGCCCAGACTCGCCTCAAGGTGATCTTCAGTGATGACAGTGACCTGGAAGACCTTGTC
TCA
GCTGACACACAACTTGTAGAGGAGCCTAAGAGGCGAGGGACTGCTTCCCGTACCCGGGGCCAAACTA
GG
AAGGGACGTAGCTTAAAGACAGATGCGGTGGTTGCTATAGAAAGTACCCCTGGACATTCCAGTGTCAG
T
GGGAGGACTCGGAGGGCCAGGAAGGTGGCTTCAAGAAATTGTGAAGAAGAGAGTCCCAAAGCACCCCTC
TGT
GTCTGGGCCAGCCAGGGACCCGAGATCATGAGAAGTATCCCTGAAGAGGAGCCAGTGGACAACCATC
TG
GAAAAAAGCTTCGAGATTCTCAGGGGTTCTGATGGGGAAGACTCGGCCTCAGGTGAGAAGGCGGCAGC
T
GCAGACACTGGTCTACCCGTAGGAGAGTGTGAGGTGTTGAGACGGGACTCCAGCAAGGCAGAGAGACCT
GTC
TTGTACTCAGACACGGAGGCCAATAGTGACCCTAGTCCTTGGCTCCCACCCTTCTCAGTTCCTGCAC
CC
ATTGATCTTTCTACCCTGGATTCCATTTCTGACTCATTGAGCATTGCTTTCCGTGGTGTTAGTCACTG
C
CCTCCAAGTGGGCTCTATGCTCACCTCTGCCGCTTCTTGGCCCTGTGTCTGGGCCACCGAGATCCTTAT
GCC
ACTGCGTTCCTTGTTGCTGAGTCTATCTCCATCACCTGCCGTCACCAGCTGCTCACCCACTTGCACC
GA
CAGCTCAGCAAGGCCCAGAAGCAGCAAGAATCACCTGAACTGGCAGAGCATCTGCAGAGGCTGGACCT
G
AAGGAGAGGCCCGGAGGTGTCCCACTGGCCCGTATCCAGCGCCTCTTTTCCTTTAAGGCTTTGGGATCT
GGC
TGCTTCCCCCAGGCAGAGAAGGAGAGTTTCCAGGAGCGCCTGGCTCTGATCCCTAGTGGGGTGACTG
TC
TGTGTGTTGGCTCTGGCCACCCTCCAGCCTGGAACCTTGAGCAACACTCTTTTACTGACCCGCCTGGA
A
AAGGACAACCCCCCAATTACTGTGAAGATCCCCACTGCCCAAAATAAGCTCCCTCTAAGCGCAGTGCTG
AAA
GAGTTTGATGCCATCCAGAAGGACCAAAAAGAAAACAGCAGCTGTACTGAGAAACGAGTATGGTGGA
CG
GGCCGGCTGGCACTGGACCAAAGGATGGAGGCACTCATCACCGCCCTGGAGGAACAGGTGCTGGGCTG
C
TGGAGGGGGCTGCTGCTGCCATGCAGTGCTGACCCCAGCCTTGCCCAGGAGGCCTCCAAACTACAAGAG
CTG
CTGCGGGAATGTGGCTGGGAATATCCTGACTCCACTCTCCTGAAAGTCATCCTTAGTGGGGCCAGAA
TC
CTCACCAGCCAGGATGTTCAGGCCTTGGCGTGTGGGCTGTGCCCAGCCCAGCCTGACCGAGCCCAAGT
G
CTCCTGAGCGAGGCAGTAGGACAGGTTCAGAGCCAGGAGGCCCCTCGAAGTCAACATCTTGTATTGGTG
TTA
GACAAGGACCTGCAAAAGCTGCCTTGGGAAAGCACGCCCATCCTCCAAGCACAGCCGGTCACCCGGC
TG
CCCTCCTTCCGCTTCCTGCTCAGCTACACAGTCACTAAAGAGGCTGGAGCCTCATCAGTGCTGAGCCA
A
GGTGTTGATCCACAGAATACCTTCTATGTGCTAAACCCTCACAGTAACCTGTCGAGCACAGAGGAGAGA
TTT
CGAGCCAGTTTTAGCAGTGAAACTGGCTGGAAAGGAGTGATTGGGGAAGTGCCAAGCCTCGATCAGG
TG
CAGGCTGCCCTGACAGAGCGGGATTTATATATCTACGCAGGGCACGGAGCCGGTGCCCGCTTCCTTGA
T
GGGCAGGCTGTCCTGCGGCTGAGCTGCCGGGCGGTGGCCCTGCTGTTCGGCTGCAGCAGTGCAGCCCTT
GCC
GTGCATGGAAACCTGGAGGGAGCTGGTATCGTGCTCAAGTACATCATGGCTGGCTGCCCCTTGTTTC
TA
GGTAATCTCTGGGATGTGACTGACCGTGACATTGACCGTTACACAGAGGCTTTGCTGCAGGGCTGGCT
G
GGAGCAGGCCCAGGGGCTCCCTTTCTCTACTATGCCAGCCAAGCCCGCCAGGCCCCTCGACTCAAGTAC
CTC
ATTGGTGCTGCACCTGTAGCCTACGGCCTACCTATCTCTCTGCAGACACCCTGA


Translation (2118 aa):
MRNFKGVNFATLLCSKEETQQLLPDLKEFLSRSRTDFPSSRTDAERRQICDTILRACTQQLTAKLDCPGH
L
RSILDLAELACDGYLLSTPQRPPLYLERILFILLRNGSTQGSPDTVLRLAQPLHACLVQNSGEAAPQDY
E
AVTRGSFSLFWKGAEALLERRAAFSTRLNALSFLVLLEDGSVPCEVPHFASPTACRLVAAYQLYDATGQ
G
LDEADADFLYEVLSRHLIRVLVGEGGSSPGPLSPQRALCLLEITLEHCRRLCWNHHHRQAARAVERARN
H
LEKTSVAPSLQLCQMGVELLEAVEERPGAVAQLLRKAAAVLINSIEAPSPPLRALYDSCQFFLSGLERG
I
RRHCGLDAILSLFAFLGGYSSLVRHLRE
VSEASSKQQQCLLQMHFQGFHLFTGIVYDFAQGCQATELAQ
L
VDGCRSAAVWMLEALEGLSGGELADYLSMT
ASYTSNLAYSFFSQKLYEEACVISEPVCQHLGSATSGAC
P
EVPPEK
LHRCFRLHVESLKKLGKQAQGCKMVTLWLAALKPYSLEHMVEPVTFWVRVKMDASRAGDKELQ
L
QTLRDSLSCWDPETQSLLLREELRAYKSVRADTGQERFNIICDLLELSPEETAAGAWARATYLVELAQV
L
CYHNFTQQTN
CSALDAVQEALQLLESVSPEAQEQDRLLDDKAQALLWLYICTLEAKMQEGIERDRRAQA
P
SNLEEFEVNDLNYEDKLQEDRFLYSSIAFNLAADA
AQSKCLDQALTLWKEVLTKGRAPAVRCLQQTAAS
L
QILAAVYQLVAK
PLQALETLLLLQIVSKRLQDHAKAASSSCQLTQLLLNLGCPSYAQLYLEEAESSLRS
L
DQTSDACQLLSLTCALLGSQLCWACQK
VTAGVSLLLSVLRDPALQKSSKAWYLLRVQALQVLAFYLSLS
S
NLLSSALREQLWDQ
GWQTPETALIDAHKLLRSIIILLMGSDVLSIQKAATESPFLDYGENLVQKWQVLT
E
VLTCSERLVGRLGRLGNVSEAKAFCLEALKLTTKLQIPR
QCALFLVLKGELELARGDIDLCQSDLQQVL
F
LLESST
EFGVVTQHPDSVKKVHTQKGKHKAQGPCFPPLSEEEPFLKGPALELVDTVLNEPGPIQSSVNS
S
PVLKTKPPPNPGFLSHLPSCDCLLCASPALSAVCLRWVLVTAGVRLATGHKAQGLDLLQAVLTRCPAAT
K
RFTQSLQASLNHRTTPSCVPSLFDEIMAQVYTHLALEFLNQTSEKSLGKVLASGLKFVATRIQSLEIWR
A
HLLLVQALAKLAHFSCCTSELFASSWGWHPPLVKSLPVLEPAKIRRQKCSGRGRRRIASVPPPLHNSSQ
K
GLEEEGPPCTPKPPGRARQAGPRVPFTIFEEVHPTKSKLQVPLAPRVHRRAQTRLK
VIFSDDSDLEDLV
S
ADTQLVEEPKRRGTASRTRGQTRKGRSLKTDAVVAIESTPGHSSVSGRTRRARKVASRNCEEESPKAPL
C
VWASQGPEIMRSIPEEEPVDNHLEKSFEILRGSDGEDSAS
GEKAAAADTGLPVGECEVLRRDSSKAERP
V
LYSDTEANSDPSPWLPPFSVPAPI
DLSTLDSISDSLSIAFRGVSHCPPSGLYAHLCRFLALCLGHRDPY
A
TAFLVAESISITCRHQLLTHLHRQL
SKAQKQQESPELAEHLQRLDLKERPGGVPLARIQRLFSFKALGS
G
CFPQAEKESFQERLALIPS
GVTVCVLALATLQPGTLSNTLLLTRLEKDNPPITVKIPTAQNKLPLSAVL
K
EFDAIQKDQKENSSCTEKRVWWTGRLALDQRME
ALITALEEQVLGCWRGLLLPCSADPSLAQEASKLQE
L
LRECGWEYPDSTLLK
VILSGARILTSQDVQALACGLCPAQPDRAQVLLSEAVGQVQSQEAPRSQHLVLV
L
DK
DLQKLPWESTPILQAQPVTRLPSFRFLLSYTVTKEAGASSVLSQGVDPQNTFYVLNPHSNLSSTEER
F
RASFS
SETGWKGVIGEVPSLDQVQAALTERDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAAL
A
VHGNLEGAGIVLKYIMAG
CPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPFLYYASQARQAPRLKY
L
IGAAPVAYGLPISLQTP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser