NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27761.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27761.2 Public Mus musculus 15 Slc2a13 23 108 98 CCDS HistoryNCBI Gene:239606Re-query CCDS DB by CCDS ID:27761.2Re-query CCDS DB by GeneID:239606See the combined annotation on chromosome 15 in Sequence Viewer

Public Note for CCDS 27761.1
The coding region has been updated to extend the N-terminus to one that is more supported by available transcript and conservation data.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 27761.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000109283.1 ENSMUSP00000104906.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109283.1Link to Ensembl Protein Viewer:ENSMUSP00000104906.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000109283Re-query CCDS DB by Protein ID:ENSMUSP00000104906
Original member Current member NCBI NM_001033633.3 NP_001028805.2 Accepted alive Link to Nucleotide Sequence:NM_001033633.3Link to Protein Sequence:NP_001028805.2Re-query CCDS DB by Nucleotide ID:NM_001033633Re-query CCDS DB by Protein ID:NP_001028805Link to BLAST:NP_001028805.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001028805.2 637 Q3UHK1 637 100% 0 0

Chromosomal Locations for CCDS 27761.2

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 91272154 91272380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 91276063 91276215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 91276367 91276488 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 91321571 91321696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 91343702 91343822 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 91349967 91350130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 91412109 91412217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 91497393 91497601 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 91516335 91516494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 91572575 91573097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1914 nt):
ATGTCCCGCAAGGCGAGCGAGGACGTGGAGTACACGCTGCGCAGCCTGAGCAGCCTGATGGGCGAGAGGC
GC
CGCCGGCAGCCGGAGCCGGGGGCGCCAGGCGGGGAGCGCAGCCTCCTGGCCGCCGAGTCGGCCGCCAG
C
CTGCAGGGCGCGGAGCTGGAGCGCGCGGCGCGCAGGCAGTTCCAGCGCGACGAGACCCCGGCCTTCGTG
TAC
GCGGCCGCCGCCTTCTCGGCGCTCGGCGGCTTCCTGTTCGGCTACGACACCGGCGTGGTGTCGGGGG
CC
ATGCTGCTGCTGCGGCGCCAGATGCGCCTGGGCGCGATGTGGCAGGAGCTGCTGGTGTCGGGCGCGGT
G
GGCGCGGCCGCCGTCGCGGCGCTGGCCGGAGGGGCCCTGAACGGCGCCCTCGGTCGGCGCAGCGCCATC
CTG
CTGGCCAGCGCCCTGTGCACCGTGGGCTCCGCCGTGCTGGCCGCCGCCGCCAACAAGGAGACGCTGC
TG
GCCGGCCGCCTGGTCGTGGGGCTCGGCATCGGCATCGCATCCATGACCGTGCCCGTGTACATCGCGGA
G
GTTTCTCCACCCAACCTGAGAGGTCGCCTGGTCACCATCAACACCCTCTTCATCACAGGCGGACAGTTC
TTT
GCAAGTGTTGTCGATGGCGCCTTCAGTTACCTGCAGAAGGATGGATGGAGGTACATGTTGGGACTTG
CG
GCCATTCCAGCTGTTATACAGTTTCTTGGATTCCTCTTTTTGCCCGAAAGCCCTCGGTGGCTGATTCA
G
AAGGGACAGACTCAGAAGGCCCGCCGAATTTTGTCCCAGATGCGTGGCAATCAGACCATTGATGAGGAG
TAT
GACAGCATCAGGAACAGTATCGAGGAGGAGGAAAAGGAAGCCACCGCAGCTGGACCTATAATCTGCA
GA
ATGCTGAGTTACCCCCCAACTCGCCGAGCGTTAGTTGTGGGATGTGGCTTACAGATGTTCCAGCAACT
C
TCGGGCATCAACACTATCATGTACTACAGCGCAACCATCCTCCAGATGTCCGGCGTGGAAGATGACAGA
CTT
GCAATATGGCTGGCTTCGATCACAGCATTCACCAATTTCATTTTCACACTAGTGGGAGTCTGGCTCG
TC
GAGAAAGTGGGTCGCAGGAAGCTTACCTTTGGTAGTTTGGCAGGTACCACAGTAGCACTGATTATCCT
T
GCCCTGGGATTTTTGCTCTCGGCACAGGTCTCACCACGGGTCACTTTTAGACCAACGACTCCTTCGGAT
CAA
AATACCACCTGCACGGGATACAGTTACTGCAATGAGTGTATGCTGGATCCAGACTGTGGTTTCTGCT
AC
AAGATCAACGGTTCAGCTGTCATTGATTCCTCCTGTGTTCCAGTTAACAAAGCCTCTACAACTGAAGC
A
GCCTGGGGCAGGTGTGATAATGAAACCAAGTTCAAAGCTGAAGGTGCTCACTGGGCTTACAGTTTCTGC
CCT
ACCCCCTACTCCTGGACAGCACTCGTGGGCCTGGTGTTGTACCTTGTTTTCTTTGCACCTGGAATGG
GA
CCAATGCCCTGGACCGTGAACTCTGAAATCTATCCTCTCTGGGCAAGAAGTACAGGAAATGCGTGCTC
A
GCTGGAATAAACTGGATTTTCAACGTGCTGGTTTCTTTGACCTTTTTACACACAGCAGAGTATCTTACA
TAC
TATGGAGCATTCTTCCTCTACGCCGGATTCGCCGCTGTGGGACTGCTTTTTGTCTATGGCTGCCTCC
CT
GAAACCAAGGGGAAAAAATTGGAGGAAATCGAATCGCTCTTTGACCACCGGCTATGTTCATGTGGCGC
T
GCCGACTCGGATGAAGGGAGGTACATTGAGTACATCCGCGTGAAGGGAAGCAACTATCATCTCTCCGAC
AAC
GACGCTTCTGACGTGGAGTAA


Translation (637 aa):
MSRKASEDVEYTLRSLSSLMGERRRRQPEPGAPGGERSLLAAESAASLQGAELERAARRQFQRDETPAFV
Y
AAAAFSALGGFLFGYDTGVVSGAMLLLRRQMRLGAMWQELLVSGAVGAAAVAALAGGALNGALGRRSAI
L
LASALCTVGSAVLAAAANKETLLAGRLVVGLGI
GIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQF
F
ASVVDGAFSYLQKDGW
RYMLGLAAIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEE
Y
DSIRNSIEEEEKEATA
AGPIICRMLSYPPTRRALVVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDR
L
AIWLASITAFTNFIFTLVGVWLVEKVGRRKLTFGSLA
GTTVALIILALGFLLSAQVSPRVTFRPTTPSD
Q
NTTCTGY
SYCNECMLDPDCGFCYKINGSAVIDSSCVPVNKASTTEAAWGRCDNETKFKAEGAHWAYSFC
P
TPYSWTALVGLVLYLVFFAP
GMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLT
Y
Y
GAFFLYAGFAAVGLLFVYGCLPETKGKKLEEIESLFDHRLCSCGAADSDEGRYIEYIRVKGSNYHLSD
N
DASDVE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser