NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, January 22, 2020, starting at 8:00 a.m. EST for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27745.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27745.1 Public Mus musculus 15 Miox 23 108 98 CCDS HistoryNCBI Gene:56727Re-query CCDS DB by CCDS ID:27745.1Re-query CCDS DB by GeneID:56727See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 27745.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023282.8 ENSMUSP00000023282.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023282.8Link to Ensembl Protein Viewer:ENSMUSP00000023282.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000023282Re-query CCDS DB by Protein ID:ENSMUSP00000023282
Original member Current member NCBI NM_019977.2 NP_064361.2 Accepted alive Link to Nucleotide Sequence:NM_019977.2Link to Protein Sequence:NP_064361.2Re-query CCDS DB by Nucleotide ID:NM_019977Re-query CCDS DB by Protein ID:NP_064361Link to BLAST:NP_064361.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_064361.2 285 Q9QXN5 285 100% 0 0

Chromosomal Locations for CCDS 27745.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 89334503 89334517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89334972 89335052 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89335278 89335358 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89335488 89335650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89335840 89335907 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89336015 89336124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89336228 89336295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89336394 89336443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89336530 89336642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 89336740 89336848 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (858 nt):
ATGAAGGTCGATGTGGGCCCAGACCCTTCCCTGGTCTATCGACCCGATGTGGACCCAGAGATGGCCAAAA
GC
AAGGACAGCTTCCGAAACTATACTTCAGGCCCGCTGCTGGATCGTGTCTTTACCACATACAAGCTCAT
G
CACACTCACCAGACTGTGGACTTCGTCAGCAGGAAGCGCATCCAGTATGGAAGCTTCTCTTACAAGAAG
ATG
ACCATCATGGAGGCTGTGGGCATGCTGGATGATCTGGTGGACGAATCTGACCCAGACGTAGATTTCC
CC
AACTCCTTCCACGCGTTCCAGACCGCGGAGGGCATCCGGAAAGCCCACCCGGACAAGGACTGGTTCCA
C
CTGGTCGGACTTTTGCACGATCTGGGGAAAATTATGGCTCTGTGGGGGGAACCTCAGTGGGCTGTTGTT
GGA
GACACGTTCCCCGTGGGCTGCCGTCCCCAGGCCTCTGTGGTGTTCTGTGACTCTACTTTCCAGGACA
AT
CCTGACCTCCAGGATCCTCGATACAGCACAGAACTCGGCATGTACCAGCCTCACTGTGGACTAGAGAA
C
GTCCTTATGTCCTGGGGCCATGATGAGTACCTATACCAGATGATGAAGTTCAACAAGTTCTCCCTGCCT
TCA
GAGGCCTTCTACATGATCCGATTCCACTCCTTCTATCCGTGGCACACCGGCGGTGACTACCGGCAGC
TG
TGCAGCCAGCAGGACCTGGATATGCTGCCCTGGGTGCAAGAGTTCAACAAGTTTGATCTCTACACGAA
G
TGCCCTGACCTACCGGATGTGGAGAGCCTGCGGCCCTACTATCAAGGGCTGATTGACAAGTACTGCCCG
GGC
ACCCTGAGCTGGTGA


Translation (285 aa):
MKVDVGPDPSLVYRPDVDPEMAKSKDSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVSRKRIQYGSFSYKK
M
TIMEAVGMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDK
DWFHLVGLLHDLGKIMALWGEPQWAVV
G
DTFPVGCRPQASVVFCDSTFQDNPDLQDPRY
STELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLP
S
E
AFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPYYQGLIDKYCP
G
TLSW




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser