NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27575.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27575.1 Public Mus musculus 15 Slc52a2 21 106 86 CCDS HistoryNCBI Gene:52710Re-query CCDS DB by CCDS ID:27575.1Re-query CCDS DB by GeneID:52710See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 27575.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023220 ENSMUSP00000023220 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023220Link to Ensembl Protein Viewer:ENSMUSP00000023220Re-query CCDS DB by Nucleotide ID:ENSMUST00000023220Re-query CCDS DB by Protein ID:ENSMUSP00000023220
Original member Current member NCBI NM_029643.3 NP_083919.1 Accepted alive Link to Nucleotide Sequence:NM_029643.3Link to Protein Sequence:NP_083919.1Re-query CCDS DB by Nucleotide ID:NM_029643Re-query CCDS DB by Protein ID:NP_083919Link to BLink:NP_083919.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083919.1 450 Q9D8F3-1 450 100% 0 0

Chromosomal Locations for CCDS 27575.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 76539473 76539602 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76539694 76540579 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76540672 76540795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76540914 76541126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1353 nt):
ATGGCAGCACCTCCGCTGGGCCGACTGGTGCTGACCCATCTGCTGGTGGCCCTTTTCGGCATGGGCTCCT
GG
GCTGCTGTCAACGGGATCTGGGTAGAGCTGCCGGTAGTGGTGAAAGAGCTCCCGGAGGGTTGGAGCCT
C
CCTTCCTACCTCTCTGTGCTTGTGGCGCTGGGAAACCTGGGTCTGCTGCTGGTGACTCTGTGGAGGCGT
CTG
GCTCGCGGCAAGGGCGAGCAAGTCCCCATCCGAGTGGTTCAGGGGCTAGGCATAGTGGGCACAGGCC
TA
CTGGCCTCTCTGTGGAACCACGTGGCCCCAGTGGCAGGAAAGCCGTACTCAGTGGCCTTCCTAACGCT
G
GCGTTTGTGCTGGCATTGGCCTGCTGTGCTTCTAATGTCACTTTCCTGCCCTTCTTGAGCCACCTCCCA
CCC
CCCTTTTTACGGTCTTTCTTCCTGGGTCAGGGCCTGAGTGCCCTCCTGCCCTGTGTGCTAGCCCTGG
GT
CAAGGGGTGGGCCGCCTTGAGTGCCTGCATGTGCCTGCCAACAGGACCACTGGGCCTCCGATCGAGGT
G
TCTCCCATTAATTTCCCTGAACGGTTTTCTGCCACCACGTTCTTCTGGGTGTTGACTGCCCTTCTGGGC
ACT
TCAGCAGCTGCCTTCCAAGGCCTCCTGTTACTACTGCCATCCCCGACATCTGAACCCACAACAGGTA
CA
GGGCTTCGGGTAGAAACACCAGGAACAGAGGAGGAAGAGGAAGAGGAAGAGGCCTCACCTTTGCAGGA
G
CCACCAGGCCAGGTGGCAGGCATTGTTTCCAGCCCAGACCCTAAGGCCCATCAGCTGTTCTCTTCCCGA
AGT
GCCTGTCTACTGGGCCTGCTGGCCATCACCAATGCTCTGACCAATGGCGTGCTGCCCGCTGTACAGA
GC
TTTTCCTGCCTGCCCTATGGGCGCCTGGCCTACCACTTGGCTGTCGTACTGGGTAGCTGTGCCAACCC
C
CTTGCCTGCTTTCTGGCCATGGCAGTGCTGTGCAGGTCTCTGGCAGGGCTGTGTGGTCTGTCTCTGCTG
GGC
ATGCTCTTGGGCTCCTACCTGATGACACTGGCAGCCTTAAGTCCCTGTCCTCCTCTGGTGGGCACCT
CT
GCAGGTGTGGTCCTCGTGGTACTCTCATGGGTCCTGTGCGCAGGCACGTTCTCGTATATCAAGGTGGC
G
ATCAGTTCCATGTTACACAGCGGAGGCCGGCCAGCACTGCTCGCTGCTGGCGTGGCTATTCAGGTGGGC
TCT
CTGCTGGGTGCGGTCGCCATGTTCCCTCCTACCAGCATCTACCGAGTATTTCGCAGCGGAAAGGACT
GT
GTGGACCAGTGTGGCCTCTGA


Translation (450 aa):
MAAPPLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYLSVLVALGNLGLLLVTLWRR
L
ARGKGEQVPIRVVQGLGIVGTGLLASLWNHVAPVAGKPYSVAFLTLAFVLALACCASNVTFLPFLSHLP
P
PFLRSFFLGQGLSALLPCVLALGQGVGRLECLHVPANRTTGPPIEVSPINFPERFSATTFFWVLTALLG
T
SAAAFQGLLLLLPSPTSEPTTGTGLRVETPGTEEEEEEEEASPLQEPPGQVAGIVSSPDPKAHQLFSSR
S
ACLLGLLAITNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSCANPLACFLAMAVLC
RSLAGLCGLSLL
G
MLLGSYLMTLAALSPCPPLVGTSAGVVLV
VLSWVLCAGTFSYIKVAISSMLHSGGRPALLAAGVAIQVG
S
LLGAVAMFPPTSIYRVFRSGKDCVDQCGL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser