NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27507.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27507.1 Public Mus musculus 15 Efr3a 23 108 98 CCDS HistoryNCBI Gene:76740Re-query CCDS DB by CCDS ID:27507.1Re-query CCDS DB by GeneID:76740See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27507.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000015146.15 ENSMUSP00000015146.9 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000015146.15Link to Ensembl Protein Viewer:ENSMUSP00000015146.9Re-query CCDS DB by Nucleotide ID:ENSMUST00000015146Re-query CCDS DB by Protein ID:ENSMUSP00000015146
Original member Current member NCBI NM_133766.4 NP_598527.2 Accepted alive Link to Nucleotide Sequence:NM_133766.4Link to Protein Sequence:NP_598527.2Re-query CCDS DB by Nucleotide ID:NM_133766Re-query CCDS DB by Protein ID:NP_598527Link to BLAST:NP_598527.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598527.2 819 Q8BG67-1 819 100% 0 0

Chromosomal Locations for CCDS 27507.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 65787237 65787246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65815335 65815411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65818433 65818560 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65819720 65819870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65824614 65824735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65829727 65829876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65837435 65837572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65842642 65842720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65845909 65846044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65848148 65848309 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65849763 65849877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65851124 65851175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65852961 65853133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65853531 65853606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65854629 65854790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65855416 65855547 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65856522 65856589 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65857464 65857591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65861652 65861743 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65865878 65865926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65866724 65866827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65867270 65867319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65871153 65871258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2460 nt):
ATGCCTACCCGGGTGTGCTGCTGCTGCTCTGCTTTGCGTCCTCGCTACAAACGTCTGGTGGACAACATAT
TC
CCTGAAGATCCCAAAGATGGCCTTGTTAAAGCTGATATGGAAAAACTGACATTTTATGCAGTATCTGC
A
CCAGAGAAACTCGATCGAATTGGTGCCTACCTGGCGGAAAGGCTGAGCAGGGATGTTGTCAGACACCGT
TCT
GGGTACGTTCTAATCGCTATGGAGGCATTGGACCAGCTTCTTATGGCCTGCCATTCTCAGAGCATCA
AG
CCATTTGTAGAAAGCTTCCTTCACATGGTAGCAAAGCTCCTGGAATCAGGGGAACCAAAGCTTCAGGT
T
CTTGGAACAAATTCTTTTGTCAAATTTGCAAATATTGAAGAAGATACACCGTCCTATCATAGACGTTAT
GAC
TTCTTTGTATCTCGATTCAGTGCCATGTGTCACTCCTGTCATAGTGATCCAGAAATACGAACCGAGA
TT
CGCATTGCTGGAATAAGAGGCATTCAAGGTGTGGTTCGCAAAACAGTTAATGATGAACTTCGGGCTAC
C
ATTTGGGAACCACAGCATATGGATAAGATTGTTCCATCCCTTTTGTTTAACATGCAGAAGATAGAAGAA
GTT
GACAGTCGCCTAGGCCCACCTTCTTCCCCCTCTGCAGCTGACAAAGAAGAGAACCCTGCAGTGCTGG
CA
GAGAGCTGTTTCAGAGAACTGCTGGGCCGAGCAACTTTTGGGAATATGAATAATGCTGTTAGGCCAGT
T
TTTGCGCATTTAGATCATCACAAGCTGTGGGATCCTAATGAGTTTGCAGTCCACTGCTTTAAGATTATA
ATG
TATTCTATCCAGGCTCAGTATTCTCACCATGTGATCCAAGAGATTCTAGGACACCTTGATGCTCGTA
GG
AAGGATTCTCCACGGGTTCGAGCAGGTATCATTCAGGTTCTGTTAGAGGCGGTCGCCATTGCTGCTAA
A
GGTTCCATAGGGCCTACAGTGCTGGAAGTCTTCAACACCCTGTTGAAGCACCTGCGGCTCAGTGTGGAA
CTG
GAAGCCAACGATTCCCAGAAGGGGTCTGTAGGCAGCGTCACCGTAAGCTCCAAGGACAACGATGAGA
AG
ATTGTGCAGAATGCTGTCATCCAGACAATAGGATTTTTTGGAAGTAACTTACCAGACTATCAGAGGTC
A
GAGATCATGATGTTCATCATGGGGAAAGTGCCTGTGTTTGGAACATCCACTCATACTTTGGATATCAGT
CAA
CTAGGGGATTTGGGAACCAGGAGGATTCAGATAATGCTGCTGAGATCTTTGCTCATGGTGACTTCTG
GA
TACAAAGCCAAGACAATTGTTACTGCACTGCCTGGGTCATTTCTGGATCCTCTATTGTCGCCATCCCT
C
ATGGAAGACTATGAGCTGAGGCAGTTAGTCTTGGAAGTAATGCACAACCTAATGGATCGCCATGACAAC
AGA
GCAAAGCTCCGCGGTATCAGGATAATACCAGATGTGGCTGACTTGAAGATAAAAAGAGAGAAAATTT
GT
CGACAAGATACGAGCTTCATGAAAAAGAATGGGCAACAGCTATACAGGCACATATATCTGGGCTGCAA
A
GAGGAGGACAATGTTCAGAAAAACTATGAGCTTCTTTATACATCTCTGGCGCTGATAACTATTGAGCTC
GCC
AATGAAGAGGTGGTTATTGACCTCATTCGACTGGCCATTGCTTTACAGGACAGTGCAATTATCAATG
AA
GATAACCTGTCAATGTTTCATCGTTGTGGGATCATGGCCCTGGTTGCAGCTTATCTCAACTTTGTGAG
T
CAGATGATAGCCGTTCCAGCATTTTGCCAGCATGTTAGCAAGGTTATTGAAACTCGAACTATGGAAGCC
CCT
TATTTTCTACCAGAGCATATTTTCCGAGATAAATGCATGCTTCCGAAATCTTTAGAGAAACATGACA
AA
AATTTATATTTTTTGACCAACAAGATTGCGGAGTCCCTGGGTGGCAGCGGGTACAGTGTGGAGAGGCT
G
ACAGTTCCTTATGTGCCACAGGTGACAGATGAAGATCGCCTTTCTAGAAGAAAAAGTATTGTGGATACT
GTA
TCTATTCAGGTGGATATTTTATCCAACAGTGTGCCTTCTGATGATGTGGTTAGCAACACCGAGGAGA
TC
ACCTTTGAAGCACTGAAGAAAGCAATTGATACCAATGGAATGGAAGAACAGGAAAAGGAAAAGAGACG
T
CTTGTGATAGAGAAGTTCCAGAAAGCACCATTTGAAGAAATAGCAGCACAGTGTGAATCCAAAGCAAAT
TTG
CTTCATGATAGACTTGCTCAAATATTGGAGCTCACCATACGCCCTCCTCCCAGTCCATCTGGAACAT
TG
ACCGTTACTTCTGGGCATACCCAATACCAGTCCGTCCCAGTCTATGAGATGAAGTTTCCAGATCTGTG
T
GTATATTGA


Translation (819 aa):
MPTRVCCCCSALRPRYKRLVDNIFPEDPKDGLVKADMEKLTFYAVSAPEKLDRIGAYLAERLSRDVVRHR
S
GYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRY
D
FFVSRFSAMCHSCHSDPEIRT
EIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE
V
D
SRLGPPSSPSAADKEENPAVLAESCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKII
M
YSIQ
AQYSHHVIQEILGHLDARRKDSPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVE
L
EANDSQKGSVGSVTVSSKDNDEKIVQNAVIQTI
GFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDIS
Q
L
GDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRHDN
R
AKLRGI
RIIPDVADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITIEL
A
NEEVVIDLIRLAIALQ
DSAIINEDNLSMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIETRTMEA
P
YFLPEHIFRDKC
MLPKSLEKHDKNLYFLTNKIAESLGGSGYSVERLTVPYVPQVTDEDRLSRRKSIVDT
V
SIQVDILSNSVPSDDV
VSNTEEITFEALKKAIDTNGMEEQEKEKRRLVIEKFQKAPFEEIAAQCESKAN
L
LHDRLAQILELTI
RPPPSPSGTLTVTSGHTQYQSVPVYEMKFPDLCVY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser