NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS27091.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27091.1 Public Mus musculus 14 Prmt5 23 108 98 CCDS HistoryNCBI Gene:27374Re-query CCDS DB by CCDS ID:27091.1Re-query CCDS DB by GeneID:27374See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27091.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000023873.11 ENSMUSP00000023873.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023873.11Link to Ensembl Protein Viewer:ENSMUSP00000023873.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000023873Re-query CCDS DB by Protein ID:ENSMUSP00000023873
Original member Current member NCBI NM_013768.3 NP_038796.2 Accepted alive Link to Nucleotide Sequence:NM_013768.3Link to Protein Sequence:NP_038796.2Re-query CCDS DB by Nucleotide ID:NM_013768Re-query CCDS DB by Protein ID:NP_038796Link to BLAST:NP_038796.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038796.2 637 Q8CIG8 637 99.843% 0 1

Chromosomal Locations for CCDS 27091.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 54507795 54507947 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54508892 54508956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54509289 54509405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54509544 54509637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54509834 54509943 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54510879 54511054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54511141 54511263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54511348 54511406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54511502 54511579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54511993 54512154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54513291 54513454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54514597 54514646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54514775 54514887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54515303 54515437 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54516106 54516191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54516497 54516615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54517247 54517356 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1914 nt):
ATGGCGGCGATGGCAGTCGGAGGTGCTGGTGGCAGCCGCGTGTCCAGCGGGAGGGACCTGAATTGCGTCC
CC
GAAATAGCTGACACACTGGGTGCTGTGGCCAAGCAGGGGTTTGATTTCCTCTGCATGCCTGTCTTCCA
C
CCGCGTTTCAAGAGGGAGTTCATTCAGGAACCTGCTAAGAATCGGCCTGGCCCCCAGACACGATCAGAC
CTA
CTGCTGTCAGGAAGGGACTGGAATACGCTAATTGTGGGAAAGCTTTCTCCATGGATTCATCCAGACT
CA
AAAGTGGAGAAGATCCGAAGGAACTCTGAAGCGGCTATGTTACAGGAGTTGAATTTTGGGGCATATCT
G
GGTCTTCCAGCTTTCCTATTGCCCCTTAATCAGGAAGATAACACGAATCTGGCCAGAGTTCTGACCAAC
CAC
ATCCACACTGGCCACCACTCTTCCATGTTCTGGATGAGGGTACCCTTGGTGGCCCCAGAGGACCTGA
GA
GATGATGTAATTGAGAATGCCCCGACTACACACACAGAGGAGTACAGTGGAGAAGAGAAAACATGGAT
G
TGGTGGCATAACTTTCGGACTCTGTGTGACTATAGCAAGAGAATTGCAGTAGCTCTTGAAATTGGAGCT
GAC
CTCCCGTCTAATCACGTCATTGACCGCTGGCTTGGAGAGCCCATCAAAGCAGCCATTCTCCCCACCA
GC
ATTTTCCTAACCAACAAGAAAGGATTTCCTGTTCTTTCTAAGGTGCAGCAGAGGCTGATCTTCCGGCT
C
CTCAAGTTGGAAGTGCAGTTTATCATCACGGGAACCAACCACCACTCAGAGAAGGAGTTCTGTTCCTAC
CTC
CAGTACTTGGAATACTTAAGCCAAAATCGCCCTCCACCCAATGCCTATGAGCTCTTTGCCAAAGGCT
AT
GAAGACTATCTGCAGTCCCCACTCCAGCCTCTGATGGACAATCTGGAATCTCAGACATATGAAGTGTT
T
GAAAAGGACCCCATCAAATACTCTCAATATCAGCAGGCTATTTATAAATGTTTGCTAGACCGAGTACCA
GAA
GAAGAAAAGGAGACCAATGTCCAGGTACTTATGGTGCTGGGTGCAGGCCGGGGTCCTCTTGTGAATG
CG
TCTCTTCGGGCAGCCAAACAGGCCGAGCGGCGGATCAGGCTGTATGCTGTGGAGAAGAACCCCAATGC
T
GTGGTGACGCTAGAGAACTGGCAGTTTGAAGAATGGGGGAGCCAGGTGACAGTTGTCTCATCAGACATG
CGG
GAATGGGTGGCTCCGGAGAAAGCTGACATCATTGTCAGTGAGCTTCTGGGTTCCTTTGCCGACAACG
AG
CTGTCACCTGAGTGTCTGGATGGAGCACAGCACTTCCTGAAAGATGATGGCGTGAGCATCCCTGGAGA
A
TACACCTCCTTCCTGGCTCCCATTTCTTCCTCTAAGCTGTACAATGAGGTCCGTGCCTGTCGGGAAAAG
GAC
CGCGATCCTGAGGCACAGTTTGAGATGCCTTATGTGGTTCGGTTGCACAACTTCCACCAGCTCTCTG
CT
CCTAAGCCCTGCTTTACCTTCAGCCATCCCAACCGAGATCCTATGATTGACAACAACCGCTACTGTAC
C
TTGGAGTTTCCTGTGGAGGTGAACACAGTGCTTCATGGCTTCGCAGGCTACTTTGAGACTGTGCTTTAC
CGG
GACATCACTCTGAGTATCCGCCCAGAGACTCACTCTCCTGGGATGTTCTCATGGTTCCCCATCTTCT
TC
CCCATTAAGCAGCCCATCACGGTGCACGAAGGCCAGAACATCTGTGTGCGTTTCTGGCGATGCAGCAA
T
TCCAAGAAAGTGTGGTACGAGTGGGCGGTGACGGCCCCCGTCTGTTCTTCTATTCACAACCCTACCGGC
CGC
TCCTATACCATTGGCCTCTAG


Translation (637 aa):
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSD
L
LLSGR
DWNTLIVGKLSPWIHPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTN
H
IHTGHHSSM
FWMRVPLVAPEDLRDDVIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGA
D
LPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKVQQRLIFRLLK
LEVQFIITGTNHHSEKEFCSY
L
QYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQ
PLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVP
E
EEKETNV
QVLMVLGAGRGPLVNASLRAAKQAERRIRLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
R
EWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLK
DDGVSIPGEYTSFLAPISSSKLYNEVRACREK
D
RDPE
AQFEMPYVVRLHNFHQLSAPKPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLY
R
DITL
SIRPETHSPGMFSWFPIFFPIKQPITVHEGQNICVRFWRCSNSKKVWYEWAVTAPVCSSIHNPTG
R
SYTIGL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser