NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27004.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27004.1 Public Mus musculus 14 Olfr728 23 108 98 CCDS HistoryNCBI Gene:258039Re-query CCDS DB by CCDS ID:27004.1Re-query CCDS DB by GeneID:258039See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27004.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000051563.2 ENSMUSP00000052079.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000051563.2Link to Ensembl Protein Viewer:ENSMUSP00000052079.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000051563Re-query CCDS DB by Protein ID:ENSMUSP00000052079
Original member Current member EBI,WTSI ENSMUST00000213685.1 ENSMUSP00000149796.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000213685.1Link to Ensembl Protein Viewer:ENSMUSP00000149796.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000213685Re-query CCDS DB by Protein ID:ENSMUSP00000149796
Original member Current member NCBI NM_001011809.2 NP_001011809.1 Accepted alive Link to Nucleotide Sequence:NM_001011809.2Link to Protein Sequence:NP_001011809.1Re-query CCDS DB by Nucleotide ID:NM_001011809Re-query CCDS DB by Protein ID:NP_001011809Link to BLAST:NP_001011809.1

Chromosomal Locations for CCDS 27004.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 50139702 50140637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (936 nt):
ATGGCTCACAATAATGAATCCACGGTATCTGAGTTTGTGCTTCTGGGACTTTCTAAATCTTGGGGACTTC
AG
CTTGTGCTTTTTACCATCTTCTTTGTCATCTATGTGACATCAGTCTTGGGCAATATCATGATTATTGT
C
ATCATTTTCTCTGATTCACACTTGAACTCTCCTATGTACTTTTTGCTCAGTAACCTTTCATTTATTGAC
ATC
TGCCAATCTAACTTTGCCACACCGAAGATGCTTGTGGACTTTTTTGTCGAATACAAAACTATTTCTT
TT
GAGGGTTGTATGGCTCAAATATTTCTTCTTCATAGCTTTGTTGGGAGTGAAATGATGTTGCTTGTAGC
T
ATGGGATATGACAGGTTTGTAGCAATATGTAAGCCACTGCACTACAATCTAATTATGAATCGGAGAGTA
TGT
ATAATTTTTGTGTCAATTTCTTGGGCAGTAGGTATCCTTCATTCTGTGAGCCATTTGGCATTTACAG
TG
AATCTGCCATTCTGTGGTCCCAATGAGGTAGATAGCTTCTTTTGTGATCTTCCCTTGGTGATAAAGCT
T
GCGTGCATGGATACGTACAGAATGGAAATTTTGACCTTGGCTAACAGTGGTATGATATCACTAAGCTGT
TTC
CTGGCTTTAATTATCTCCTATATCATCATTTTGGTCTCTGTCCAACGGCAGTCCTCTAGTGGGTCAT
CC
AAAGCCCTTTCTACACTCACGGCCCACATCACTGTAGTGATTCTTTTCTTTGGGCCTTGTATTTATTT
C
TACATATGGCCTTTTAGCAGATTGTCTGTGGATAAGTTCCTTTCTGTCTTCTATACCATTTGTACACCT
TTA
CTGAATCCTATCATATATTCTCTGAGAAATGAAGATGTGAAATCAGCCTTGAGGAAATTGAGAAACA
GT
CATATAAATCCTGGGAAAAACTAA


Translation (311 aa):
MAHNNESTVSEFVLLGLSKSWGLQLVLFTIFFVIYVTSVLGNIMIIVIIFSDSHLNSPMYFLLSNLSFID
I
CQSNFATPKMLVDFFVEYKTISFEGCMAQIFLLHSFVGSEMMLLVAMGYDRFVAICKPLHYNLIMNRRV
C
IIFVSISWAVGILHSVSHLAFTVNLPFCGPNEVDSFFCDLPLVIKLACMDTYRMEILTLANSGMISLSC
F
LALIISYIIILVSVQRQSSSGSSKALSTLTAHITVVILFFGPCIYFYIWPFSRLSVDKFLSVFYTICTP
L
LNPIIYSLRNEDVKSALRKLRNSHINPGKN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser