NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS2673.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2673.1 Public Homo sapiens 3 ACAA1 22 109 92 CCDS HistoryNCBI Gene:30Re-query CCDS DB by CCDS ID:2673.1Re-query CCDS DB by GeneID:30See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2673.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000333167.12 ENSP00000333664.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000333167.12Link to Ensembl Protein Viewer:ENSP00000333664.8Re-query CCDS DB by Nucleotide ID:ENST00000333167Re-query CCDS DB by Protein ID:ENSP00000333664
Original member NCBI NM_001607.3 NP_001598.1 Updated not alive Link to Nucleotide Sequence:NM_001607.3Link to Protein Sequence:NP_001598.1Re-query CCDS DB by Nucleotide ID:NM_001607Re-query CCDS DB by Protein ID:NP_001598
Current member NCBI NM_001607.4 NP_001598.1 Accepted alive Link to Nucleotide Sequence:NM_001607.4Link to Protein Sequence:NP_001598.1Re-query CCDS DB by Nucleotide ID:NM_001607Re-query CCDS DB by Protein ID:NP_001598Link to BLAST:NP_001598.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001598.1 424 P09110-1 424 100% 0 0

Chromosomal Locations for CCDS 2673.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 38123047 38123122 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38125565 38125710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38125826 38125881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38126162 38126341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38126510 38126700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38127786 38127866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38129290 38129388 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38131596 38131638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38131926 38132005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38133952 38134009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38136592 38136685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38136865 38137035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1275 nt):
ATGCAGAGGCTGCAGGTAGTGCTGGGCCACCTGAGGGGTCCGGCCGATTCCGGCTGGATGCCGCAGGCCG
CG
CCTTGCCTGAGCGGTGCCCCGCAGGCCTCGGCCGCGGACGTGGTGGTGGTGCACGGGCGGCGCACGGC
C
ATCTGCCGGGCGGGCCGCGGCGGCTTCAAGGACACCACCCCCGACGAGCTTCTCTCGGCAGTCATGACC
GCG
GTTCTCAAGGACGTGAATCTGAGGCCGGAACAGCTGGGGGACATCTGTGTCGGAAATGTGCTGCAGC
CT
GGGGCCGGGGCAATCATGGCCCGAATCGCCCAGTTTCTGAGTGACATCCCGGAGACTGTGCCTTTGTC
C
ACTGTCAATAGACAGTGTTCGTCGGGGCTACAGGCAGTGGCCAGCATAGCAGGTGGCATCAGAAATGGG
TCT
TATGACATTGGCATGGCCTGTGGGGTGGAGTCCATGTCCCTGGCTGACAGAGGGAACCCTGGAAATA
TT
ACTTCGCGCTTGATGGAGAAGGAGAAGGCCAGAGATTGCCTGATTCCTATGGGGATAACCTCTGAGAA
T
GTGGCTGAGCGGTTTGGCATTTCACGGGAGAAGCAGGATACCTTTGCCCTGGCTTCCCAGCAGAAGGCA
GCA
AGAGCCCAGAGCAAGGGCTGTTTCCAAGCTGAGATTGTGCCTGTGACCACCACGGTCCATGATGACA
AG
GGCACCAAGAGGAGCATCACTGTGACCCAGGATGAGGGTATCCGCCCCAGCACCACCATGGAGGGCCT
G
GCCAAACTGAAGCCTGCCTTCAAGAAAGATGGTTCTACCACAGCTGGAAACTCTAGCCAGGTGAGTGAT
GGG
GCAGCTGCCATCCTGCTGGCCCGGAGGTCCAAGGCAGAAGAGTTGGGCCTTCCCATCCTTGGGGTCC
TG
AGGTCTTATGCAGTGGTTGGGGTCCCACCTGACATCATGGGCATTGGACCTGCCTATGCCATCCCAGT
A
GCTTTGCAAAAAGCAGGGCTGACAGTGAGTGACGTGGACATCTTCGAGATCAATGAGGCCTTTGCAAGC
CAG
GCTGCCTACTGTGTGGAGAAGCTACGACTCCCCCCTGAGAAGGTGAACCCCCTGGGGGGTGCAGTGG
CC
TTAGGGCACCCACTGGGCTGCACTGGGGCACGACAGGTCATCACGCTGCTCAATGAGCTGAAGCGCCG
T
GGGAAGAGGGCATACGGAGTGGTGTCCATGTGCATCGGGACTGGAATGGGAGCCGCTGCCGTCTTTGAA
TAC
CCTGGGAACTGA


Translation (424 aa):
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT
A
VLKDVNLRPEQLGDICV
GNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNG
S
YDIGMAC
GVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKA
A
RAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTA
GNSSQVSD
G
AAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKA
GLTVSDVDIFEINEAFAS
Q
AAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE
Y
PGN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser