NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26725.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26725.1 Public Mus musculus 13 Smn1 21 106 86 CCDS HistoryNCBI Gene:20595Re-query CCDS DB by CCDS ID:26725.1Re-query CCDS DB by GeneID:20595See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26725.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022147 ENSMUSP00000022147 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022147Link to Ensembl Protein Viewer:ENSMUSP00000022147Re-query CCDS DB by Nucleotide ID:ENSMUST00000022147Re-query CCDS DB by Protein ID:ENSMUSP00000022147
Original member Current member EBI,WTSI OTTMUST00000084239 OTTMUSP00000045374 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000084239Link to Vega Protein Viewer:OTTMUSP00000045374Re-query CCDS DB by Nucleotide ID:OTTMUST00000084239Re-query CCDS DB by Protein ID:OTTMUSP00000045374
Original member Current member NCBI NM_011420.2 NP_035550.1 Accepted alive Link to Nucleotide Sequence:NM_011420.2Link to Protein Sequence:NP_035550.1Re-query CCDS DB by Nucleotide ID:NM_011420Re-query CCDS DB by Protein ID:NP_035550Link to BLAST:NP_035550.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035550.1 288 P97801 288 100% 0 0

Chromosomal Locations for CCDS 26725.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 100124894 100124965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 100126587 100126658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 100126870 100126989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 100127805 100128005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 100128215 100128361 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 100131080 100131175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 100132356 100132466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 100135689 100135736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (867 nt):
ATGGCGATGGGCAGTGGCGGAGCGGGCTCCGAGCAGGAAGATACGGTGCTGTTCCGGCGTGGCACCGGCC
AG
AGTGATGATTCTGACATTTGGGATGATACAGCATTGATAAAAGCTTATGATAAAGCTGTGGCTTCCTT
T
AAGCATGCTCTAAAGAACGGTGACATTTGTGAAACTCCAGATAAGCCAAAAGGCACAGCCAGAAGAAAA
CCT
GCCAAGAAGAATAAAAGCCAAAAGAAGAATGCCACAACTCCCTTGAAACAGTGGAAAGTTGGTGACA
AG
TGTTCTGCTGTTTGGTCAGAAGACGGCTGCATTTACCCAGCTACTATTACGTCCATTGACTTTAAGAG
A
GAAACCTGTGTCGTGGTTTATACTGGATATGGAAACAGAGAGGAGCAAAACTTATCTGACCTACTTTCC
CCG
ACCTGTGAAGTAGCTAATAGTACAGAACAGAACACTCAGGAGAATGAAAGTCAAGTTTCCACAGACG
AC
AGTGAACACTCCTCCAGATCGCTCAGAAGTAAAGCACACAGCAAGTCCAAAGCTGCTCCGTGGACCTC
A
TTTCTTCCTCCACCACCCCCAATGCCAGGGTCAGGATTAGGACCAGGAAAGCCAGGTCTAAAATTCAAC
GGC
CCGCCGCCGCCGCCTCCACTACCCCCTCCCCCCTTCCTGCCGTGCTGGATGCCCCCGTTCCCTTCAG
GA
CCACCAATAATCCCGCCACCCCCTCCCATCTCTCCCGACTGTCTGGATGACACTGATGCCCTGGGCAG
T
ATGCTAATCTCTTGGTACATGAGTGGCTACCACACTGGCTACTATATGGGTTTCAGACAAAATAAAAAA
GAA
GGAAAGTGCTCACATACAAATTAA


Translation (288 aa):
MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETPDKPKGTARRK
P
AKKNKSQKKNATTPLKQ
WKVGDKCSAVWSEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLS
P
TCEVANSTEQNTQE
NESQVSTDDSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPGSGLGPGKPGLKFN
G
PPPPPPLPPPPFLPCWMPPFPSGPP
IIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKK
E
GKCSHTN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser