NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26641.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26641.1 Public Mus musculus 13 Ahrr 21 106 86 CCDS HistoryNCBI Gene:11624Re-query CCDS DB by CCDS ID:26641.1Re-query CCDS DB by GeneID:11624See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26641.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022059 ENSMUSP00000022059 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022059Link to Ensembl Protein Viewer:ENSMUSP00000022059Re-query CCDS DB by Nucleotide ID:ENSMUST00000022059Re-query CCDS DB by Protein ID:ENSMUSP00000022059
Original member Current member EBI,WTSI OTTMUST00000055581 OTTMUSP00000026630 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000055581Link to Vega Protein Viewer:OTTMUSP00000026630Re-query CCDS DB by Nucleotide ID:OTTMUST00000055581Re-query CCDS DB by Protein ID:OTTMUSP00000026630
Original member Current member NCBI NM_009644.3 NP_033774.1 Accepted alive Link to Nucleotide Sequence:NM_009644.3Link to Protein Sequence:NP_033774.1Re-query CCDS DB by Nucleotide ID:NM_009644Re-query CCDS DB by Protein ID:NP_033774Link to BLAST:NP_033774.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033774.1 701 Q3U1U7-1 701 99.8573% 0 1

Chromosomal Locations for CCDS 26641.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 74213657 74214665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 74215372 74215510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 74215743 74215804 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 74220541 74220737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 74222901 74223034 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 74224765 74224894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 74229888 74229977 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 74257472 74257569 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 74277628 74277809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 74283037 74283101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2106 nt):
ATGATGATTCCGTCTGGAGAGTGTACATACGCCGGTAGGAAGAGAAGGAAGCCCATTCAGAAGCGGAGGC
TT
ACCATGGGAGCTGAGAAATCAAATCCTTCCAAACGGCACCGGGACCGCCTCAATACAGAGCTGGACCA
C
CTGGCCAGCCTGCTGCCATTTTCACCTGATATCATCTCCAAGCTGGACAAGCTTTCTGTCCTGCGCCTC
AGC
GTTAGCTACCTCAGGGTAAAGAGCTTCTTCCAAGCCTTGCAGGAGACATGTGTATGGTCAGCTCCAG
CC
CTGTCACCTGAAGAACACTCATACAGAGGGTTCCCCGTGCAGGAAGGACGGCTGCTGCTGGAGTCTCT
C
AATGGCTTCGCTCTGGTGGTGAGTGCCGAAGGGATGATCTTTTATGCATCGGCAACAATTGTGGACTAT
CTG
GGCTTTCATCAGACAGATGTCATGCATCAAAACATTTATGACTACATCCATGTGGATGACCGGCAGG
AC
TTCTGCAGACAGCTACACTGGGCCATGGACCCTCCTCAGGTGGTGTTTGGGCAGTCCCCACATGCTGA
C
ACAGACAATACTGTCCTGGGGAAGCTGCTCAGGGCCCAAGAAGGAGGCAAGGGCTTGCCCTCAGAGTAC
TCG
GCCTTCTTGACACGCTGCTTCATTTGTCGTGTTCGCTGCCTGCTGGACAGCACCTCTGGCTTTCTGA
CC
ATGCAGTTCCAAGGAAAACTAAAATTCCTGTTTGGACAGAAGAAGAAGACACCATCAGGAACAGCCCT
G
CCTCCTCGACTCTCATTGTTCTGCATTGTGGCACCAGTCTTGCCTTCTGTAACTGAGATGAAAATGAAA
AGC
ACATTCTTGAAGGCAAAGCACAGGGCAGACATTGTGGTTACGATGGACTCAAGGGCAAAAGCTGTTA
CA
AGTCTATGTGAATCAGAATTGCATCCCAAACTCAATTACTTAGCAGGAAAGAGCAATGGAGAAAATGG
C
ATTTCACTGTTCAGGGGACAAACAGATAGGAGCCACTGGGCCCGGGCTCTAGCCAGATCTTCATGTCTG
TGC
CTCAGGGGTGGTCCTGACCTGCTGGACCCCAAGGGGACTTCAGGGGACAGAGAAGAGGAGGACCAGA
AG
CACATACTAAGGAGATCCCCTGGTGCCTGGGGGCAGAGGGAGATGCACAAGTACAGTTATGGTTTGGA
G
ACACCAGTACACTTGAGGCACCTGAACTGGAGCACAGAACAGCGAAGTCAGGAGAGCACTACCAAGCTG
ACT
CGGCAGCCCAGTAAGAATGAGCCATCCACGTGTCTGGTGCCCCATGGTTCCTGTGTGCCCTACCCTG
GA
AGCCAGGGCATGCTTAGTGCCAGCAACATGGCTTCTTTTAGAGATTCACTAGACCATCCCACTGGTGC
C
TACTGCAGTCAGATGAACAGACCCTTGTCGGATATCCACCAGGGCCAGGTGGATCCTTCCACCTGCCAT
ATC
TCCCAGGGCAGTCTGGGATCTAGGATCCCTCTGACTGGAATGCAGCGCTTCACAGCTCGGGGATTTT
CT
ACAGAGGATGCAAAATTACCCAGCCTGCCAGTGACCATAGGCACTCCATGCAACCCAGTATTGTCACT
G
GATGTGCCAATCAAGATGGAGAATGAATCTGGGTCCCAGGATATAGTTGAAGCTAGCACAACTAGCTGT
TTG
TGGCTGGGAACCAGCGACATGGCCAGAGGACATCTGGTTGGTTTCCCTGCCAGGATGCACCTGAAAA
CA
GAGCCCGACTATAGGCAGCAGGCCTGTACCCCACACCTTGGTCATGGTATGCTGGGAACTAATCCCTA
C
AGCAGAGATACTGTTGGATCCTGTAGGGAGCATGCTCCTCTTTACTCTGCACATTGCACCTGCCTGGAT
CCA
GAGCCTCCTCATCACTTCTTCATGTGTAGCCACAGTGAGAGCCAGCACCCCTCATTGGACCAAGACT
GC
AGAGCTCCTATTGTTAAGCGTGAGCCTCTGGACTCACCATCATGGGCTGCTCCTGGTCAGGTGACTGT
G
CCCAGGATGTTCCCTAAGAGTGCCTCTAAAACTGTGATCCCATCCAAAGGCTCTGATGGAATTTTCCTA
CCC
TAG


Translation (701 aa):
MMIPSGECTYAGRKRRKPIQKRRLTMGAEKSNPSKRHRDRLNTELDHLASLLPFSPDIISKLDKLSVLRL
S
VSYLRVKSFFQ
ALQETCVWSAPALSPEEHSYRGFPVQEGRLLLESLNGFALVVSAEGMIFYASATIVDY
L
GFHQ
TDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQSPHADTDNTVLGKLLRAQEGGKGLPSEY
S
AFLTRCFICRVRCLLDSTSGFL
TMQFQGKLKFLFGQKKKTPSGTALPPRLSLFCIVAPVLPSVTEMKMK
S
TFLKAKHRADIVVTMDS
RAKAVTSLCESELHPKLNYLAGKSNGENGISLFRGQTDRSHWARALARSSCL
C
LRGGPDLLDPKGTS
GDREEEDQKHILRRSPGAWGQREMHKYSYGLETPVHLRHLNWSTEQRSQESTTKL
T
RQPSKNEPSTCLVPHGSCVPYPGSQGMLSASNMASFRDSLDHPTGAYCSQMNRPLSDIHQGQVDPSTCH
I
SQGSLGSRIPLTGMQRFTARGFSTEDAKLPSLPVTIGTPCNPVLSLDVPIKMENESGSQDIVEASTTSC
L
WLGTSDMARGHLVGFPARMHLKTEPDYRQQACTPHLGHGMLGTNPYSRDTVGSCREHAPLYSAHCTCLD
P
EPPHHFFMCSHSESQHPSLDQDCRAPIVKREPLDSPSWAAPGQVTVPRMFPKSASKTVIPSKGSDGIFL
P




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser