NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26635.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26635.1 Public Mus musculus 13 Slc12a7 23 108 98 CCDS HistoryNCBI Gene:20499Re-query CCDS DB by CCDS ID:26635.1Re-query CCDS DB by GeneID:20499See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26635.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000017900.8 ENSMUSP00000017900.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000017900.8Link to Ensembl Protein Viewer:ENSMUSP00000017900.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000017900Re-query CCDS DB by Protein ID:ENSMUSP00000017900
Original member Current member NCBI NM_011390.2 NP_035520.1 Accepted alive Link to Nucleotide Sequence:NM_011390.2Link to Protein Sequence:NP_035520.1Re-query CCDS DB by Nucleotide ID:NM_011390Re-query CCDS DB by Protein ID:NP_035520Link to BLAST:NP_035520.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035520.1 1083 Q9WVL3-1 1083 100% 0 0

Chromosomal Locations for CCDS 26635.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 73763767 73763890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73784519 73784613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73785044 73785166 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73788565 73788711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73789941 73789995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73790650 73790780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73792550 73792791 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73793924 73794135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73795098 73795265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73795604 73795702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73796767 73796824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73797527 73797701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73798419 73798537 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73798943 73799041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73799613 73799732 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73800385 73800489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73800928 73801096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73805414 73805609 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73806029 73806198 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73806306 73806437 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73808985 73809092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73809906 73810084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73813539 73813672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73814843 73814934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3252 nt):
ATGCCCACGAACTTTACGGTGGTGCCGGTGGAGGCGCGCGCCGACGGCGCCGGGGACGAAGCTGCTGAGC
GC
ACGGAAGAACCCGAGTCTCCCGAGAGCGTGGATCAAACCTCCCCTACGCCGGGAGATGGAAACCCCAG
G
GAAAACAGCCCTTTCATCAATAATGTGGAGGTGGAAAGAGAGAGCTACTTCGAGGGGAAGAACATGGCA
CTT
TTTGAGGAAGAGATGGACAGCAACCCCATGGTGTCATCACTGCTGAACAAGCTGGCCAACTATACCA
AC
CTGAGCCAGGGTGTGGTAGAGCATGAGGAAGATGAGGACAGCCGGAGGCGAGAGGTCAAGGCCCCACG
C
ATGGGCACCTTCATCGGAGTCTACCTGCCGTGCCTGCAGAACATCTTGGGTGTTATCCTTTTCCTGCGT
CTG
ACCTGGATTGTGGGGGCAGCTGGTGTTATGGAGTCCTTCCTCATTGTGGCCATGTGCTGCACCTGTA
CA
ATGCTGACAGCCATCTCCATGAGCGCCATCGCTACCAACGGCGTGGTCCCAGCGGGAGGCTCGTACTA
C
ATGATCTCCCGTTCGCTGGGGCCTGAGTTTGGAGGTGCTGTTGGCCTCTGCTTCTACTTGGGCACGACA
TTT
GCAGGCGCCATGTACATCCTGGGTACCATCGAGATCTTCCTGACCTACATCTCTCCAAGTGCGGCCA
TC
TTCCAGGCAGAGACGGCGGATGGCGAGGCGGCCGCACTGTTGAACAACATGCGTGTGTATGGCAGCTG
T
GCCCTGGCACTCATGGCGGTGGTGGTCTTTGTTGGTGTCAAATATGTCAACAAGCTGGCACTGGTCTTC
TTA
GCCTGTGTTGTGCTTTCTATCCTGGCCATCTATGCTGGTGTCATCAAGACAGCCTTTGCCCCACCTG
AC
ATCCCGGTCTGCCTTCTAGGGAACCGCACGCTGGCAAATCGCAACTTTGATACCTGTGCCAAGATGCA
G
GTTGTCAGCAACGGTACAGTGACCACTGCACTCTGGCGCCTCTTCTGCAATGGCTCCAGCTTGGGTGCC
ACC
TGTGATGAGTACTTTGCACAGAACAACGTTACTGAGATACAGGGCATCCCTGGTGTGGCCAGTGGTG
TC
TTCCTGGATAACCTGTGGAGCACATATTCAGACAAGGGGGCATTTGTGGAAAAGAAAGGTGTGTCCTC
A
GTGCCTGTGTCCGAGGAGAGCCGGCCTGGTGGATTGCCATACGTCCTCACAGACATCATGACCTACTTC
ACC
ATGCTAGTTGGCATCTACTTCCCGTCTGTAACTGGGATCATGGCAGGATCCAACCGCTCCGGGGACC
TC
AAAGACGCCCAGAAGTCTATTCCAACAGGGACCATTCTGGCCATCGTGACTACATCTTTCATTTATCT
T
TCCTGCATAGTGCTGTTTGGGGCCTGCATTGAAGGTGTAGTCCTGCGAGATAAGTTTGGGGAGGCCTTG
CAA
GGGAACCTGGTCATTGGCATGCTGGCCTGGCCATCTCCCTGGGTCATTGTGATTGGCTCCTTCTTCT
CC
ACCTGTGGTGCTGGCCTGCAGAGCCTGACTGGGGCACCCCGCCTACTGCAGGCCATTGCGCGTGACGG
A
ATCATCCCCTTCCTACAGGTGTTTGGTCATGGAAAGGCCAACGGGGAGCCCACATGGGCCCTGCTGCTC
ACG
GCTCTCATCTGTGAGACCGGTATCCTCATCGCCTCCCTGGACAGTGTGGCCCCCATCCTGTCCATGT
TC
TTCCTCATGTGCTACATGTTCGTCAATCTGGCCTGTGCCGTACAGACCCTGCTACGCACACCCAACTG
G
CGTCCACGCTTCAAGTTCTACCACTGGACCCTCTCCTTCCTTGGGATGAGTCTCTGCCTCGCGCTGATG
TTC
ATCTGCTCCTGGTACTACGCCCTTTTCGCCATGCTCATTGCCGGCTGCATCTACAAGTACATCGAGT
AC
CGCGGGGCTGAGAAGGAGTGGGGGGATGGCATCAGGGGCCTGTCACTGAATGCTGCCCGCTACGCCCT
G
CTGCGTGTGGAACATGGGCCCCCACATACCAAGAACTGGAGGCCCCAGGTGTTGGTGATGCTGAACCTG
GAC
TCGGAGCAGTGTGTAAAGCACCCCCGCCTGCTGTCCTTCACCTCTCAGCTGAAGGCTGGCAAGGGCC
TG
ACCATCGTGGGATCTGTGCTAGAGGGCACCTACTTAGACAAGCATGTGGAGGCCCAGAGGGCTGAAGA
G
AATATCCGGTCTCTGATGAGTGCAGAGAAGACGAAGGGCTTCTGCCAGCTGGTGGTGTCCTCCAACCTG
CGA
GATGGTGCGTCCCACCTGATCCAGTCGGCTGGCCTCGGTGGCATGAAACACAACACTGTCCTCATGG
CC
TGGCCAGAGGCTTGGAAGGAGGCAGATAATCCTTTCTCCTGGAAGAACTTTGTAGACACAGTCCGTGA
C
ACTACAGCAGCACATCAGGCCTTGTTGGTGGCCAAGAACATTGACTTATTCCCACAAAACCAAGAGCGC
TTC
AGCGACGGGAACATTGATGTGTGGTGGATCGTGCATGACGGGGGCATGCTCATGCTTCTGCCCTTTC
TG
CTGCGCCAGCACAAGGTGTGGCGAAAGTGCCGGATGCGCATCTTCACTGTGGCCCAGGTGGATGATAA
C
AGCATCCAGATGAAGAAGGACCTGCAGATGTTCCTGTACCACCTCAGGATCAGTGCCGAGGTGGAGGTG
GTG
GAGATGGTTGAAAATGATATTTCCGCATTCACCTATGAGAAGACGCTAATGATGGAGCAGAGGTCAC
AG
ATGCTGAAACAGATGCAGTTGTCAAAGAATGAGCGGGAGAGAGAGGCCCAGCTGATTCATGACAGGAA
C
ACTGCATCCCATACCACAGCAACTGCTAGAACCCAAGCCCCACCAACACCCGACAAAGTGCAGATGACA
TGG
ACGAAAGAGAAACTCATTGCAGAGAAACACAGGAACAAGGACACTGGCCCATCAGGCTTCAAAGACC
TC
TTCAGCCTAAAGCCGGACCAGTCCAACGTCAGGAGGATGCATACTGCTGTGAAGCTCAACGGCGTAGT
T
CTCAACAAGTCCCAGGATGCCCAACTGGTCCTGCTGAATATGCCAGGCCCCCCAAAAAGTCGGCAGGGG
GAC
GAGAACTACATGGAGTTCCTCGAGGTCCTGACGGAAGGGCTGAACAGGGTCCTCCTGGTCAGGGGTG
GT
GGCCGAGAAGTCATCACCATCTACTCCTAA


Translation (1083 aa):
MPTNFTVVPVEARADGAGDEAAERTEEPESPESVDQTSPTPGDGNPRENSPFINNVEVERESYFEGKNMA
L
FE
EEMDSNPMVSSLLNKLANYTNLSQGVVEHEEDEDSRRREVKAPRMGTFIGVYLPCLQNILGVILFLR
L
TWIVGAAGVMESFLIVAMCCTC
TMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTT
F
AGAMYILGTIEIFL
TYISPSAAIFQAETADGEAAALLNNMRVYGSCALALMAVVVFVGVKYVNKLALVF
L
ACVVLSILAIYAGVIKTAFAPPDI
PVCLLGNRTLANRNFDTCAKMQVVSNGTVTTALWRLFCNGSSLGA
T
CDEYFAQNNVTEIQGIPGVASGVFL
DNLWSTYSDKGAFVEKKGVSSVPVSEESRPGGLPYVLTDIMTYF
T
MLVGIYFPSVT
GIMAGSNRSGDLKDAQKSIPTGTILAIVTTSFIYLSCIVLFGACIEGVVLRDKFGEAL
Q
GNLVIGMLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIIPFLQ
VFGHGKANGEPTWALLL
T
ALICETGILIASLDSVAPILS
MFFLMCYMFVNLACAVQTLLRTPNWRPRFKFYHWTLSFLGMSLCLALM
F
ICSWYYALFAMLIAGCIYKYIEYR
GAEKEWGDGIRGLSLNAARYALLRVEHGPPHTKNWRPQVLVMLNL
D
SEQCVKHPRLLSFTSQLKAGKGLTIVGSVLEGTYLDKHVEAQRAEE
NIRSLMSAEKTKGFCQLVVSSNL
R
DGASHLIQSAGLGGMKHNTVLMAWPEAWKEADNPFSWKNFV
DTVRDTTAAHQALLVAKNIDLFPQNQER
F
SDGNIDVWWIVHDGGMLMLLPFLLRQHK
VWRKCRMRIFTVAQVDDNSIQMKKDLQMFLYHLRISAEVEV
V
EM
VENDISAFTYEKTLMMEQRSQMLKQMQLSKNEREREAQLIHDRNTASHTTATARTQAPPTPDKVQMT
W
TKEKLIAEKHRNKDTGPSGFKDLFSLK
PDQSNVRRMHTAVKLNGVVLNKSQDAQLVLLNMPGPPKSRQG
D
EN
YMEFLEVLTEGLNRVLLVRGGGREVITIYS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser