NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26260.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26260.1 Public Mus musculus 13 Epdr1 21 106 86 CCDS HistoryNCBI Gene:105298Re-query CCDS DB by CCDS ID:26260.1Re-query CCDS DB by GeneID:105298See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 26260.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000002885 ENSMUSP00000002885 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000002885Link to Ensembl Protein Viewer:ENSMUSP00000002885Re-query CCDS DB by Nucleotide ID:ENSMUST00000002885Re-query CCDS DB by Protein ID:ENSMUSP00000002885
Original member Current member NCBI NM_134065.4 NP_598826.3 Accepted alive Link to Nucleotide Sequence:NM_134065.4Link to Protein Sequence:NP_598826.3Re-query CCDS DB by Nucleotide ID:NM_134065Re-query CCDS DB by Protein ID:NP_598826Link to BLAST:NP_598826.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598826.3 224 Q99M71-1 224 100% 0 0

Chromosomal Locations for CCDS 26260.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 19593152 19593348 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19594447 19594655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19619294 19619562 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (675 nt):
ATGCCCGCGCGCGCTCCCCGCCGCCTGGTCCAGGGGCCTCGGGGGACCTGGCTGCTGGGAAGCCTCTGGG
TC
TGGGTGCTGTGCGGCCTGGGGATGGCGGGCTCCCTGGGAACCCCACAGCCATGCCAGGCACCCCAGCA
G
TGGGAGGGACGCCAGGTTCTGTACCAGCAGAGCAGCGGGCACAACAACCGCGCCCTGGTGTCCTACGAT
GGT
CTCAACCAGCGCGTGCGGGTGCTGGACGAGAGGAAAGCGCTGATCCCCTGCAAGAGATTATTTGAAT
AC
ATTTTACTCTATAAGGAGGGAGTGATGTTTCAGATTGAACAAGCCACCAAACAGTGTGCAAAGATCCC
C
TTGGTGGAATCCTGGGATCCTCTGGACATTCCCCAGAATTCTACCTTTGAAGATCAGTACTCCATCGGA
GGG
CCTCAGGAGCAGATCCTGGTCCAGGAGTGGTCTGACAGAAGAACAGCAAGATCCTATGAAACTTGGA
TC
GGCGTTTATACAGCCAAGGATTGTTATCCGGTCCAGGAGACCTTCATCAGGAACTACACTGTGGTCAT
G
TCCACGCGGTTCTTTGATGTGCAGCTAGGCATTAAGGACCCCTCTGTGTTCACCCCACCAAGCACATGC
CAG
GCAGCGCAGCCAGAGAAGATGAGTGACGGCTGCTCCTTGTGA


Translation (224 aa):
MPARAPRRLVQGPRGTWLLGSLWVWVLCGLGMAGSLGTPQPCQAPQQWEGRQVLYQQSSGHNNRALVSYD
G
LNQRVRVLDERKALIPCK
RLFEYILLYKEGVMFQIEQATKQCAKIPLVESWDPLDIPQNSTFEDQYSIG
G
PQEQILVQEWSDRRTARS
YETWIGVYTAKDCYPVQETFIRNYTVVMSTRFFDVQLGIKDPSVFTPPSTC
Q
AAQPEKMSDGCSL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser