NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26238.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26238.1 Public Mus musculus 13 Chrm3 21 106 86 CCDS HistoryNCBI Gene:12671Re-query CCDS DB by CCDS ID:26238.1Re-query CCDS DB by GeneID:12671See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26238.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000063093 ENSMUSP00000055579 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000063093Link to Ensembl Protein Viewer:ENSMUSP00000055579Re-query CCDS DB by Nucleotide ID:ENSMUST00000063093Re-query CCDS DB by Protein ID:ENSMUSP00000055579
Original member Current member EBI,WTSI ENSMUST00000187510 ENSMUSP00000140131 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000187510Link to Ensembl Protein Viewer:ENSMUSP00000140131Re-query CCDS DB by Nucleotide ID:ENSMUST00000187510Re-query CCDS DB by Protein ID:ENSMUSP00000140131
Original member Current member EBI,WTSI OTTMUST00000124140 OTTMUSP00000067594 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000124140Link to Vega Protein Viewer:OTTMUSP00000067594Re-query CCDS DB by Nucleotide ID:OTTMUST00000124140Re-query CCDS DB by Protein ID:OTTMUSP00000067594
Original member Current member NCBI NM_033269.4 NP_150372.1 Accepted alive Link to Nucleotide Sequence:NM_033269.4Link to Protein Sequence:NP_150372.1Re-query CCDS DB by Nucleotide ID:NM_033269Re-query CCDS DB by Protein ID:NP_150372Link to BLAST:NP_150372.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_150372.1 589 Q9ERZ3 589 100% 0 0

Chromosomal Locations for CCDS 26238.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 9877229 9878998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1770 nt):
ATGACCTTGCACAGTAACAGTACAACCTCGCCTTTGTTTCCCAACATCAGCTCTTCCTGGGTGCACAGTC
CC
TCAGAGGCGGGGCTGCCCTTGGGGACAGTCTCTCAATTGGACAGCTACAACATTTCCCAAACCTCTGG
G
AATTTCTCCTCAAATGACACCTCCAGTGACCCTCTAGGGGGCCACACCATCTGGCAAGTGGTCTTCATT
GCA
TTCTTGACTGGCTTCCTGGCATTGGTGACCATCATCGGCAACATCCTTGTCATTGTGGCATTTAAGG
TC
AACAAACAGCTGAAGACAGTCAACAACTACTTCCTCTTAAGCCTGGCCTGCGCAGATCTGATCATCGG
G
GTCATTTCCATGAACCTGTTCACGACCTACATCATTATGAACCGCTGGGCTCTGGGGAACTTAGCCTGT
GAC
CTCTGGCTTTCCATTGACTATGTGGCCAGCAATGCTTCTGTCATGAATCTGCTGGTGATCAGCTTTG
AC
AGGTACTTTTCTATTACCAGGCCACTCACTTACCGAGCCAAACGAACAACAAAACGAGCCGGTGTGAT
G
ATTGGTCTGGCTTGGGTCATCTCCTTTGTCCTGTGGGCTCCTGCCATCTTGTTCTGGCAATACTTTGTA
GGG
AAGAGAACTGTGCCCCCCGGAGAATGTTTCATTCAGTTTCTAAGTGAGCCCACCATCACCTTCGGCA
CG
GCGATCGCTGCCTTTTACATGCCTGTCACCATCATGACTATTTTATACTGGAGAATCTATAAGGAGAC
T
GAGAAACGTACCAAAGAGCTGGCTGGGCTACAGGCCTCTGGGACAGAAGCGGAAGCAGAAAACTTTGTC
CAC
CCCACAGGCAGTTCTCGAAGCTGTAGCAGCTATGAGCTACAACAGCAAGGCACGAAACGGTCATCTA
GG
AGGAAGTATGGTGGCTGTCACTTCTGGTTCACAACTAAGAGCTGGAAGCCCAGTGCTGAGCAGATGGA
C
CAAGACCACAGTAGCAGTGACAGTTGGAATAACAACGATGCTGCTGCCTCCCTGGAAAACTCTGCTTCT
TCT
GATGAAGAGGATATTGGCTCAGAGACCAGAGCCATCTATTCCATTGTACTCAAGCTGCCGGGTCATA
GC
ACCATCCTCAACTCTACCAAGCTACCCTCCTCAGATAACCTGCAGGTGCCAGACAAGGACCTGGGGAC
T
ATGGATGTAGAGAGAAATGCCCATAAGCTTCAGGCCCAGAAGAGTATGGATGACCGTGACAACTGTCAG
AAG
GACTTCTCCAAGCTCCCCATCCAGTTAGAGTCTGCCGTGGACACAGCCAAGACCTCTGACACCAACT
CC
TCGGTGGACAAGACCACGGCCGCTCTACCTCTGTCCTTCAAAGAAGCCACGCTGGCTAAGAGGTTTGC
T
CTCAAGACCAGAAGTCAGATCACCAAGCGGAAAAGGATGTCGCTCATCAAGGAGAAGAAGGCCGCCCAG
ACA
CTCAGTGCCATCTTGCTGGCTTTCATCATCACGTGGACCCCCTACAACATCATGGTCCTGGTGAACA
CC
TTCTGTGACAGCTGCATACCCAAAACCTATTGGAATCTGGGCTACTGGCTGTGCTATATCAACAGCAC
C
GTGAACCCCGTGTGCTATGCCCTGTGCAACAAGACATTCAGAACCACCTTCAAGATGCTTCTCTTATGC
CAG
TGTGACAAGAGGAAGCGGCGCAAACAGCAGTACCAGCAGAGACAGTCCGTCATTTTTCACAAGCGAG
TG
CCTGAGCAGGCCTTGTAG


Translation (589 aa):
MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVSQLDSYNISQTSGNFSSNDTSSDPLGGHTIWQVVFI
A
FLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLAC
D
LWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFV
G
KRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFV
H
PTGSSRSCSSYELQQQGTKRSSRRKYGGCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSAS
S
DEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPDKDLGTMDVERNAHKLQAQKSMDDRDNCQ
K
DFSKLPIQLESAVDTAKTSDTNSSVDKTTAALPLSFKEATLAKRFALKTRSQITKRKRMSLIKEKKAAQ
T
LSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLC
Q
CDKRKRRKQQYQQRQSVIFHKRVPEQAL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser