NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS2604.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2604.1 Public Homo sapiens 3 HRH1 24 110 108 CCDS HistoryNCBI Gene:3269Re-query CCDS DB by CCDS ID:2604.1Re-query CCDS DB by GeneID:3269See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2604.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000397056.1 ENSP00000380247.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397056.1Link to Ensembl Protein Viewer:ENSP00000380247.1Re-query CCDS DB by Nucleotide ID:ENST00000397056Re-query CCDS DB by Protein ID:ENSP00000380247
Original member Current member EBI ENST00000431010.3 ENSP00000397028.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000431010.3Link to Ensembl Protein Viewer:ENSP00000397028.2Re-query CCDS DB by Nucleotide ID:ENST00000431010Re-query CCDS DB by Protein ID:ENSP00000397028
Original member Current member EBI ENST00000438284.2 ENSP00000406705.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000438284.2Link to Ensembl Protein Viewer:ENSP00000406705.2Re-query CCDS DB by Nucleotide ID:ENST00000438284Re-query CCDS DB by Protein ID:ENSP00000406705
Original member Current member NCBI NM_000861.3 NP_000852.1 Accepted alive Link to Nucleotide Sequence:NM_000861.3Link to Protein Sequence:NP_000852.1Re-query CCDS DB by Nucleotide ID:NM_000861Re-query CCDS DB by Protein ID:NP_000852Link to BLAST:NP_000852.1
Original member Current member NCBI NM_001098211.2 NP_001091681.1 Accepted alive Link to Nucleotide Sequence:NM_001098211.2Link to Protein Sequence:NP_001091681.1Re-query CCDS DB by Nucleotide ID:NM_001098211Re-query CCDS DB by Protein ID:NP_001091681Link to BLAST:NP_001091681.1
Original member Current member NCBI NM_001098212.2 NP_001091682.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001098212.2Link to Protein Sequence:NP_001091682.1Re-query CCDS DB by Nucleotide ID:NM_001098212Re-query CCDS DB by Protein ID:NP_001091682Link to BLAST:NP_001091682.1
Original member Current member NCBI NM_001098213.2 NP_001091683.1 Accepted alive Link to Nucleotide Sequence:NM_001098213.2Link to Protein Sequence:NP_001091683.1Re-query CCDS DB by Nucleotide ID:NM_001098213Re-query CCDS DB by Protein ID:NP_001091683Link to BLAST:NP_001091683.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000852.1 487 P35367 487 100% 0 0
NP_001091681.1 487 P35367 487 100% 0 0
NP_001091682.1 487 P35367 487 100% 0 0
NP_001091683.1 487 P35367 487 100% 0 0

Chromosomal Locations for CCDS 2604.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 11259038 11260501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1464 nt):
ATGAGCCTCCCCAATTCCTCCTGCCTCTTAGAAGACAAGATGTGTGAGGGCAACAAGACCACTATGGCCA
GC
CCCCAGCTGATGCCCCTGGTGGTGGTCCTGAGCACTATCTGCTTGGTCACAGTAGGGCTCAACCTGCT
G
GTGCTGTATGCCGTACGGAGTGAGCGGAAGCTCCACACTGTGGGGAACCTGTACATCGTCAGCCTCTCG
GTG
GCGGACTTGATCGTGGGTGCCGTCGTCATGCCTATGAACATCCTCTACCTGCTCATGTCCAAGTGGT
CA
CTGGGCCGTCCTCTCTGCCTCTTTTGGCTTTCCATGGACTATGTGGCCAGCACAGCGTCCATTTTCAG
T
GTCTTCATCCTGTGCATTGATCGCTACCGCTCTGTCCAGCAGCCCCTCAGGTACCTTAAGTATCGTACC
AAG
ACCCGAGCCTCGGCCACCATTCTGGGGGCCTGGTTTCTCTCTTTTCTGTGGGTTATTCCCATTCTAG
GC
TGGAATCACTTCATGCAGCAGACCTCGGTGCGCCGAGAGGACAAGTGTGAGACAGACTTCTATGATGT
C
ACCTGGTTCAAGGTCATGACTGCCATCATCAACTTCTACCTGCCCACCTTGCTCATGCTCTGGTTCTAT
GCC
AAGATCTACAAGGCCGTACGACAACACTGCCAGCACCGGGAGCTCATCAATAGGTCCCTCCCTTCCT
TC
TCAGAAATTAAGCTGAGGCCAGAGAACCCCAAGGGGGATGCCAAGAAACCAGGGAAGGAGTCTCCCTG
G
GAGGTTCTGAAAAGGAAGCCAAAAGATGCTGGTGGTGGATCTGTCTTGAAGTCACCATCCCAAACCCCC
AAG
GAGATGAAATCCCCAGTTGTCTTCAGCCAAGAGGATGATAGAGAAGTAGACAAACTCTACTGCTTTC
CA
CTTGATATTGTGCACATGCAGGCTGCGGCAGAGGGGAGTAGCAGGGACTATGTAGCCGTCAACCGGAG
C
CATGGCCAGCTCAAGACAGATGAGCAGGGCCTGAACACACATGGGGCCAGCGAGATATCAGAGGATCAG
ATG
TTAGGTGATAGCCAATCCTTCTCTCGAACGGACTCAGATACCACCACAGAGACAGCACCAGGCAAAG
GC
AAATTGAGGAGTGGGTCTAACACAGGCCTGGATTACATCAAGTTTACTTGGAAGAGGCTCCGCTCGCA
T
TCAAGACAGTATGTATCTGGGTTGCACATGAACCGCGAAAGGAAGGCCGCCAAACAGTTGGGTTTTATC
ATG
GCAGCCTTCATCCTCTGCTGGATCCCTTATTTCATCTTCTTCATGGTCATTGCCTTCTGCAAGAACT
GT
TGCAATGAACATTTGCACATGTTCACCATCTGGCTGGGCTACATCAACTCCACACTGAACCCCCTCAT
C
TACCCCTTGTGCAATGAGAACTTCAAGAAGACATTCAAGAGAATTCTGCATATTCGCTCCTAA


Translation (487 aa):
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLS
V
ADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRT
K
TRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKCETDFYDVTWFKVMTAIINFYLPTLLMLWFY
A
KIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTP
K
EMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQ
M
LGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
M
AAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser