NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS25926.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25926.1 Public Mus musculus 12 Foxa1 23 108 98 CCDS HistoryNCBI Gene:15375Re-query CCDS DB by CCDS ID:25926.1Re-query CCDS DB by GeneID:15375See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25926.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044380.7 ENSMUSP00000041118.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044380.7Link to Ensembl Protein Viewer:ENSMUSP00000041118.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000044380Re-query CCDS DB by Protein ID:ENSMUSP00000041118
Original member Current member NCBI NM_008259.4 NP_032285.2 Accepted alive Link to Nucleotide Sequence:NM_008259.4Link to Protein Sequence:NP_032285.2Re-query CCDS DB by Nucleotide ID:NM_008259Re-query CCDS DB by Protein ID:NP_032285Link to BLAST:NP_032285.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032285.2 468 P35582 468 100% 0 0

Chromosomal Locations for CCDS 25926.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 57542026 57543360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57545664 57545735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1407 nt):
ATGTTAGGGACTGTGAAGATGGAAGGGCATGAGAGCAACGACTGGAACAGCTACTACGCGGACACGCAGG
AG
GCCTACTCCTCTGTCCCTGTCAGCAACATGAACTCCGGCCTGGGCTCTATGAACTCCATGAACACCTA
C
ATGACCATGAACACCATGACCACGAGCGGCAACATGACCCCGGCTTCCTTCAACATGTCCTACGCCAAC
ACG
GGCTTAGGGGCCGGCCTGAGTCCCGGTGCTGTGGCTGGCATGCCAGGGGCCTCTGCAGGCGCCATGA
AC
AGCATGACTGCGGCGGGCGTCACGGCCATGGGTACGGCGCTGAGCCCGGGAGGCATGGGCTCCATGGG
C
GCGCAGCCCGCCACCTCCATGAACGGCCTGGGTCCCTACGCCGCCGCCATGAACCCGTGCATGAGTCCC
ATG
GCGTACGCGCCGTCCAACCTGGGCCGCAGCCGCGCGGGGGGCGGCGGCGACGCCAAGACATTCAAGC
GC
AGCTACCCTCACGCCAAGCCGCCTTACTCCTACATCTCGCTCATCACGATGGCCATCCAGCAGGCGCC
C
AGCAAGATGCTCACGCTGAGCGAGATCTACCAGTGGATCATGGACCTCTTCCCCTATTACCGCCAGAAC
CAG
CAGCGCTGGCAGAACTCCATCCGCCACTCGCTGTCCTTCAACGATTGTTTCGTCAAGGTGGCACGAT
CC
CCGGACAAGCCAGGCAAGGGCTCCTACTGGACGCTGCACCCGGACTCCGGCAACATGTTCGAGAACGG
C
TGCTACTTGCGCCGCCAAAAGCGCTTCAAGTGTGAGAAGCAGCCGGGGGCCGGAGGTGGGAGTGGGGGC
GGC
GGCTCCAAAGGGGGCCCAGAAAGTCGCAAGGACCCCTCAGGCCCGGGGAACCCCAGCGCCGAGTCAC
CC
CTTCACCGGGGTGTGCACGGAAAGGCTAGCCAGCTAGAGGGCGCGCCGGCCCCAGGGCCCGCCGCCAG
C
CCCCAGACTCTGGACCACAGCGGGGCCACGGCGACAGGGGGCGCTTCGGAGTTGAAGTCTCCAGCGTCT
TCA
TCTGCGCCCCCCATAAGCTCCGGGCCAGGGGCGCTAGCATCTGTACCCCCCTCTCACCCGGCTCACG
GC
CTGGCACCCCACGAATCTCAGCTGCATCTGAAAGGGGATCCCCACTACTCCTTTAATCACCCCTTCTC
C
ATCAACAACCTCATGTCCTCCTCCGAGCAACAGCACAAGCTGGACTTCAAGGCATACGAGCAGGCGCTG
CAG
TACTCTCCTTATGGCGCTACCTTGCCCGCCAGTCTGCCCCTTGGCAGCGCCTCAGTGGCCACGAGGA
GC
CCCATCGAGCCCTCAGCCCTGGAGCCAGCCTACTACCAAGGTGTGTATTCCAGACCCGTGCTAAATAC
T
TCCTAG


Translation (468 aa):
MLGTVKMEGHESNDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYAN
T
GLGAGLSPGAVAGMPGASAGAMNSMTAAGVTAMGTALSPGGMGSMGAQPATSMNGLGPYAAAMNPCMSP
M
AYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQN
Q
QRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGSGG
G
GSKGGPESRKDPSGPGNPSAESPLHRGVHGKASQLEGAPAPGPAASPQTLDHSGATATGGASELKSPAS
S
SAPPISSGPGALASVPPSHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQAL
Q
YSPYGATLPASLPLGSASVATRSPIEPSALEPAYYQGVYSRPVLNTS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser