NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS25644.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25644.1 Public Mus musculus 11 Slc25a19 23 108 98 CCDS HistoryNCBI Gene:67283Re-query CCDS DB by CCDS ID:25644.1Re-query CCDS DB by GeneID:67283See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25644.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000021089.10 ENSMUSP00000021089.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000021089.10Link to Ensembl Protein Viewer:ENSMUSP00000021089.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000021089Re-query CCDS DB by Protein ID:ENSMUSP00000021089
Original member Current member EBI ENSMUST00000178003.7 ENSMUSP00000137534.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178003.7Link to Ensembl Protein Viewer:ENSMUSP00000137534.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000178003Re-query CCDS DB by Protein ID:ENSMUSP00000137534
Original member Current member NCBI NM_001252384.1 NP_001239313.1 Accepted alive Link to Nucleotide Sequence:NM_001252384.1Link to Protein Sequence:NP_001239313.1Re-query CCDS DB by Nucleotide ID:NM_001252384Re-query CCDS DB by Protein ID:NP_001239313Link to BLAST:NP_001239313.1
Original member Current member NCBI NM_026071.3 NP_080347.1 Accepted alive Link to Nucleotide Sequence:NM_026071.3Link to Protein Sequence:NP_080347.1Re-query CCDS DB by Nucleotide ID:NM_026071Re-query CCDS DB by Protein ID:NP_080347Link to BLAST:NP_080347.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001239313.1 318 Q9DAM5 318 100% 0 0
NP_080347.1 318 Q9DAM5 318 100% 0 0

Chromosomal Locations for CCDS 25644.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 115615409 115615591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 115616521 115616651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 115617518 115617701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 115620877 115621047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 115623872 115624027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 115624199 115624330 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (957 nt):
ATGGTTGGCTATGACGCCAAAGCAGATGTCAGGAGTAACTCCAAGTTGGAGGTGGCGGTGGCGGGATCAG
TG
TCAGGATTTGTCACCCGTGCCCTGATCAGCCCTTTGGACGTCATCAAGATCCGTTTCCAGCTCCAGAT
T
GAACGCCTGTGTCCAAGTGACCCCAATGCCAAATACCACGGAATCTTCCAGGCAGCCAAGCAGATCCTG
CAA
GAGGAAGGCCCAAGAGCATTCTGGAAAGGACACGTTCCAGCCCAGATTCTGTCCATAGGCTACGGAG
CT
GTCCAATTTTTGGCCTTTGAAGAGTTGACTGAGCTGCTCTACCAAGCCAACTTGTACCAAACGCACCA
G
TTCTCAGCGCACTTTGTGTGCGGCGGCCTGTCTGCTGGCACTGCCACCCTCACCGTACACCCTGTGGAC
GTC
CTGCGTACCCGCCTTGCCGCTCAGGGCGAGCCCAAGATCTATAACAATCTGCGAGAGGCCATACGGA
CC
ATGTATAAGACCGAGGGCCCCTTCGTCTTCTACAAAGGCTTGACTCCCACCGTGATCGCCATCTTCCC
C
TACGCGGGCCTGCAGTTCTCCTGCTACCGCTCCTTAAAACGTGCCTATGACTGGCTCATACCACCAGAC
GGA
AAGCAAACAGGGAACCTTAAAAACCTGCTTTGTGGCTGTGGTTCGGGAGTTATCAGCAAGACCTTTA
CA
TATCCCCTGGACCTCATCAAGAAGCGCCTGCAGGTGGGCGGGTTCGAACATGCCCGGTCTGCCTTTGG
C
CAGGTGCGGAGCTACAGGGGCCTCCTGGACCTCACCCAGCAGGTACTACAGGAAGAAGGCACCCGGGGC
TTC
TTCAAGGGCCTGTCCCCCAGCCTGATGAAGGCTGCACTCTCCACTGGCTTCATGTTCTTCTGGTACG
AG
CTCTTCTGTAACCTCTTCCACTGCATAAGGAGGGAAGACAGATAG


Translation (318 aa):
MVGYDAKADVRSNSKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPNAKYHGIFQAAKQIL
Q
EEGPRAFWKGHVPAQILSIGYGAVQ
FLAFEELTELLYQANLYQTHQFSAHFVCGGLSAGTATLTVHPVD
V
LRTRLAAQGEPK
IYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPD
G
KQT
GNLKNLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRG
F
FKGLSPSLMKAALSTGFMFFWYELFCNLFHCIRREDR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser