NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS2561.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2561.2 Public Homo sapiens 3 TRNT1 22 109 92 CCDS HistoryNCBI Gene:51095Re-query CCDS DB by CCDS ID:2561.2Re-query CCDS DB by GeneID:51095See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 2561.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000251607.10 ENSP00000251607.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000251607.10Link to Ensembl Protein Viewer:ENSP00000251607.6Re-query CCDS DB by Nucleotide ID:ENST00000251607Re-query CCDS DB by Protein ID:ENSP00000251607
Original member Current member EBI,WTSI ENST00000434583.5 ENSP00000415100.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000434583.5Link to Ensembl Protein Viewer:ENSP00000415100.1Re-query CCDS DB by Nucleotide ID:ENST00000434583Re-query CCDS DB by Protein ID:ENSP00000415100
Original member Current member NCBI NM_182916.2 NP_886552.2 Accepted alive Link to Nucleotide Sequence:NM_182916.2Link to Protein Sequence:NP_886552.2Re-query CCDS DB by Nucleotide ID:NM_182916Re-query CCDS DB by Protein ID:NP_886552Link to BLAST:NP_886552.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_886552.2 434 Q96Q11-1 434 99.7696% 0 1

Chromosomal Locations for CCDS 2561.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 3129041 3129188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 3137260 3137453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 3140510 3140648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 3144584 3144710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 3146430 3146623 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 3147450 3147703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 3147906 3148154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1305 nt):
ATGCTGAGGTGCCTGTATCATTGGCACAGGCCAGTGCTGAACCGTAGGTGGAGTAGGCTGTGCCTTCCGA
AG
CAGTATCTATTCACAATGAAGTTGCAGTCTCCCGAATTCCAGTCACTTTTCACAGAAGGACTGAAGAG
T
CTGACAGAATTATTTGTCAAAGAGAATCACGAATTAAGAATAGCAGGAGGAGCAGTGAGGGATTTATTA
AAT
GGAGTAAAGCCTCAGGATATAGATTTTGCCACCACTGCTACCCCTACTCAAATGAAGGAGATGTTTC
AG
TCGGCTGGGATTCGGATGATAAACAACAGAGGAGAAAAGCACGGAACAATTACTGCCAGGCTTCATGA
A
GAAAATTTTGAGATTACTACACTACGGATTGATGTCACCACTGATGGAAGACATGCTGAGGTAGAATTT
ACA
ACTGACTGGCAGAAAGATGCGGAACGCAGAGATCTCACTATAAATTCTATGTTTTTAGGTTTTGATG
GC
ACTTTATTTGACTACTTTAATGGTTATGAAGATTTAAAAAATAAGAAAGTTAGATTTGTTGGACATGC
T
AAACAGAGAATACAAGAGGATTATCTTAGAATTTTAAGATACTTCAGGTTTTATGGGAGAATTGTAGAC
AAA
CCTGGTGACCATGATCCTGAGACTTTGGAAGCAATTGCAGAAAATGCAAAAGGCTTGGCTGGAATAT
CA
GGAGAAAGGATTTGGGTGGAACTGAAAAAAATTCTTGTTGGTAACCATGTAAATCATTTGATTCACCT
T
ATCTATGATCTTGATGTGGCTCCTTATATAGGTTTACCTGCTAATGCAAGTTTAGAAGAATTTGACAAA
GTC
AGTAAAAATGTTGATGGTTTTTCACCAAAGCCAGTGACTCTTTTGGCCTCATTATTCAAAGTACAAG
AT
GATGTCACAAAATTGGATTTGAGGTTGAAGATCGCAAAAGAGGAGAAAAACCTTGGCTTATTTATAGT
T
AAAAATAGGAAAGATTTAATTAAAGCAACAGATAGTTCAGACCCATTGAAACCCTATCAAGACTTCATT
ATA
GATTCTAGGGAACCTGATGCAACTACTCGTGTATGTGAACTACTGAAGTACCAAGGAGAGCACTGTC
TC
CTAAAGGAAATGCAGCAGTGGTCCATTCCTCCATTTCCTGTAAGTGGCCATGACATCAGAAAAGTGGG
C
ATTTCTTCAGGAAAAGAAATTGGGGCTCTATTACAACAGTTGCGAGAACAGTGGAAAAAAAGTGGTTAC
CAA
ATGGAAAAAGATGAACTTCTGAGTTACATAAAGAAGACCTAA


Translation (434 aa):
MLRCLYHWHRPVLNRRWSRLCLPKQYLFTMKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLL
N
GVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITAR
LHEENFEITTLRIDVTTDGRHAEVEF
T
TDWQKDAERRDLTINSMFL
GFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVD
K
PGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYI
GLPANASLEEFDK
V
SKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFI
I
D
SREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGY
Q
MEKDELLSYIKKT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser