NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS25524.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25524.1 Public Mus musculus 11 Nsf 23 108 98 CCDS HistoryNCBI Gene:18195Re-query CCDS DB by CCDS ID:25524.1Re-query CCDS DB by GeneID:18195See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25524.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000103075.10 ENSMUSP00000099364.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000103075.10Link to Ensembl Protein Viewer:ENSMUSP00000099364.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000103075Re-query CCDS DB by Protein ID:ENSMUSP00000099364
Original member Current member NCBI NM_008740.4 NP_032766.2 Accepted alive Link to Nucleotide Sequence:NM_008740.4Link to Protein Sequence:NP_032766.2Re-query CCDS DB by Nucleotide ID:NM_008740Re-query CCDS DB by Protein ID:NP_032766Link to BLAST:NP_032766.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032766.2 744 P46460 744 100% 0 0

Chromosomal Locations for CCDS 25524.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 103823238 103823259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103823739 103823794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103827211 103827324 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103828432 103828566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103846374 103846453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103847994 103848060 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103858895 103859028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103861893 103862049 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103863239 103863334 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103872159 103872346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103872591 103872665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103873145 103873310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103882742 103882941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103910443 103910598 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103913316 103913391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103913801 103913908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103916506 103916672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103926148 103926187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103928744 103928843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103930730 103930815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103953970 103953981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2235 nt):
ATGGCGGGCCGGACTATGCAAGCTGCGAGATGCCCTACTGATGAATTATCTTTAAGCAACTGTGCGGTTG
TG
AACGAAAAAGATTTCCAGTCTGGCCAGCATGTGATGGTGAGGACGTCCCCCAATCACAAGTACATATT
T
ACGCTGAGGACCCATCCGTCAGTGGTTCCAGGATGCATCGCGTTCAGCTTGCCTCAGCGAAAATGGGCT
GGA
CTTTCTATTGGACAGGACATAGAAGTTGCCTTGTATTCGTTTGACAAAGCCAAGCAGTGCATCGGCA
CA
ATGACCATCGAGATCGACTTCCTGCAGAAGAAGAACATCGACTCCAACCCTTACGACACCGACAAGAT
G
GCCGCCGAGTTCATCCAGCAGTTCAACAACCAGGCCTTCTCAGTGGGGCAGCAGCTTGTCTTTAGCTTC
AAT
GATAAGCTCTTTGGATTACTGGTGAAGGACATTGAAGCCATGGATCCCAGCATCCTGAAGGGAGAGC
CT
GCATCAGGCAAAAGGCAGAAGATTGAGGTAGGCCTGGTTGTTGGAAACAGTCAAGTTGCATTTGAAAA
A
GCAGAAAATTCGTCGCTCAATCTTATCGGCAAAGCTAAAACCAAGGAAAATCGCCAGTCCATCATCAAT
CCC
GACTGGAACTTTGAGAAAATGGGGATCGGCGGTCTGGATAAGGAGTTCTCGGACATTTTCCGAAGAG
CA
TTTGCTTCTCGGGTGTTCCCCCCGGAGATCGTGGAACAGATGGGTTGCAAACATGTTAAAGGCATCCT
G
TTATACGGACCCCCTGGTTGTGGTAAAACTCTCTTGGCTCGACAGATTGGCAAGATGCTGAATGCGAGA
GAG
CCCAAGGTGGTCAATGGGCCAGAAATCCTTAACAAGTATGTGGGAGAATCAGAGGCTAACATTCGTA
AA
CTCTTTGCTGATGCCGAAGAGGAGCAAAGGAGGCTTGGTGCTAACAGTGGCTTGCACATCATCATCTT
T
GATGAAATCGATGCCATCTGCAAGCAGAGAGGGAGCATGGCCGGCAGCACTGGAGTGCATGACACCGTG
GTC
AACCAGCTGCTGTCCAAGATCGATGGCGTTGAGCAGCTGAACAACATCCTCGTTATCGGAATGACCA
AT
AGACCAGATTTGATAGACGAAGCTCTCCTTCGACCCGGAAGACTGGAAGTTAAAATGGAGATAGGCTT
G
CCAGATGAGAAGGGTCGACTCCAGATCCTTCATATCCACACAGCAAGGATGAGAGGGCACCAGTTACTG
TCT
GCAGATGTGGACATCAAGGAGCTGGCTGTGGAGACTAAGAATTTCAGTGGCGCTGAGCTGGAGGGTC
TG
GTGCGAGCAGCGCAGTCCACAGCCATGAACAGACATATCAAGGCCAGCACCAAAGTAGAAGTAGACAT
G
GAGAAGGCAGAGAGCCTGCAGGTGACAAGAGGGGACTTCCTTGCTTCCCTGGAGAACGATATCAAACCA
GCA
TTTGGCACCAACCAAGAGGATTATGCAAGTTACATTATGAATGGGATCATCAAGTGGGGTGACCCCG
TG
ACCCGAGTCCTAGATGACGGAGAGCTGCTGGTCCAGCAAACGAAAAACAGTGACCGGACACCACTCGT
T
AGTGTCCTCCTAGAAGGGCCTCCTCACAGCGGGAAGACTGCCCTGGCTGCAAAGATTGCCGAGGAATCC
AAC
TTCCCCTTCATCAAGATCTGCTCACCTGATAAGATGATTGGCTTCTCCGAGACAGCCAAGTGTCAGG
CC
ATGAAGAAGATCTTTGATGATGCTTACAAATCTCAGCTCAGCTGTGTGGTCGTGGATGACATTGAGAG
G
CTGCTCGATTATGTCCCCATTGGTCCCCGGTTCTCCAACCTGGTATTGCAGGCTCTTCTTGTGTTACTG
AAA
AAGGCGCCTCCTCAGGGCCGCAAGCTTCTTATCATCGGGACCACCAGCCGCAAAGATGTCCTGCAGG
AA
ATGGAGATGCTGAACGCCTTCAGCACCACCATCCACGTGCCCAACATTGCCACAGGAGAGCAGCTGCT
G
GAAGCTCTGGAGCTTTTGGGCAACTTCAAAGATAAGGAACGCACCACAATTGCTCAGCAAGTCAAAGGG
AAG
AAAGTCTGGATAGGAATCAAGAAGTTACTAATGTTGATTGAGATGTCCCTGCAGATGGATCCTGAGT
AC
CGTGTGAGGAAATTCTTGGCCCTCATGAGAGAAGAAGGCGCTAGTCCCCTGGACTTTGATTGA


Translation (744 aa):
MAGRTMQAARCPTDELSLSNCAVVNEKDFQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWA
G
LSIGQDIE
VALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSF
N
DKLFGLLVKDIEAMDPSILKGEPASGKRQK
IEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIIN
P
DWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQM
GCKHVKGILLYGPPGCGKTLLARQIGKMLNAR
E
PKVVNGPEILNKYVGESEANIRKLFADAEEEQRR
LGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTV
V
NQLLSKIDGVEQLNNILVI
GMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLL
S
ADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIK
ASTKVEVDMEKAESLQVTRGDFLASLENDIKP
A
FGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLE
GPPHSGKTALAAKIAEES
N
FPFIKICSPDKMIGFSETAKCQAMKK
IFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLL
K
KAPPQ
GRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKG
K
KVWIGIKKLLMLIEMSLQ
MDPEYRVRKFLALMREEGASPLDFD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser