NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, May 21, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS25485.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25485.1 Public Mus musculus 11 Mpp2 23 108 98 CCDS HistoryNCBI Gene:50997Re-query CCDS DB by CCDS ID:25485.1Re-query CCDS DB by GeneID:50997See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25485.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000017458.10 ENSMUSP00000017458.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000017458.10Link to Ensembl Protein Viewer:ENSMUSP00000017458.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000017458Re-query CCDS DB by Protein ID:ENSMUSP00000017458
Original member NCBI NM_016695.4 NP_057904.1 Updated not alive Link to Nucleotide Sequence:NM_016695.4Link to Protein Sequence:NP_057904.1Re-query CCDS DB by Nucleotide ID:NM_016695Re-query CCDS DB by Protein ID:NP_057904
Current member NCBI NM_016695.5 NP_057904.1 Accepted alive Link to Nucleotide Sequence:NM_016695.5Link to Protein Sequence:NP_057904.1Re-query CCDS DB by Nucleotide ID:NM_016695Re-query CCDS DB by Protein ID:NP_057904Link to BLAST:NP_057904.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057904.1 552 Q9WV34-1 552 100% 0 0

Chromosomal Locations for CCDS 25485.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 102059317 102059493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102060421 102060549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102060767 102060969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102061496 102061657 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102061901 102061969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102062055 102062160 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102062251 102062382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102063188 102063415 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102064294 102064443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102064569 102064721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102080653 102080771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102085300 102085330 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1659 nt):
ATGCCGGTTGCTGCCACGAACTCCGAGTCTGCTATGCAGCAAGTCTTGGACAACCTGGGATCCCTGCCCA
AT
GCCACTGGGGCCGCGGAACTGGACCTGATCTTTCTTCGAGGCATAATGGAAAGTCCGATAGTCAGATC
C
CTGGCCAAGGCCCACGAGCGGCTGGAGGAGACGAAGTTGGAGGCCGTCCGGGATAACAACCTGGAGCTG
GTG
CAGGAAATCCTTCGGGACCTGGCAGAGCTGGCAGAGCAGAGCAGCACCGCTGCAGAGCTGGCACGCA
TC
CTCCAGGAGCCCCACTTCCAGTCCCTCCTGGAGACACATGACTCAGTGGCTTCAAAGACCTATGAGAC
A
CCACCCCCAAGCCCAGGCCTGGATCCCACGTTTAGCAACCAGCCAGTACCTCCTGATGCGGTGCGCATG
GTG
GGCATTCGGAAGACTGCAGGAGAACACCTGGGTGTGACATTCCGAGTGGAGGGTGGTGAGCTGGTGA
TT
GCCCGCATTCTGCATGGGGGCATGGTGGCTCAGCAAGGTCTGCTGCATGTCGGTGACATCATCAAGGA
A
GTGAATGGACAGCCAGTGGGCAGCGATCCCCGGGCACTGCAGGAGCTCCTGCGCAGTGCCAGTGGCAGT
GTC
ATCCTCAAGATCTTGCCCAGCTACCAGGAACCCCACCTGCCCCGACAGGTATTTGTTAAATGCCACT
TC
GACTATGACCCTGCCCGGGACAGTCTCAGCCCCTGCAAGGAGGCAGGCCTGCGCTTCAACGCGGGGGA
C
TTGCTCCAGATTGTAAACCAAGATGATGCCAACTGGTGGCAGGCATGCCACGTAGAAGGCGGCAGTGCC
GGC
CTCATCCCCAGCCAGCTGTTGGAGGAGAAACGGAAAGCATTTGTCAAGCGGGACCTGGAACTGACCC
CG
ACCTCAGGGACCCTATGCGGCAGCCTTTCAGGAAAGAAAAAGAAGCGAATGATGTATTTGACCACCAA
G
AATGCAGAGTTTGACCGCCATGAGCTGCTCATTTATGAGGAGGTGGCCCGCATGCCCCCATTCCGCAGG
AAA
ACCCTGGTACTGATTGGCGCGCAGGGTGTGGGCCGGCGCAGCCTGAAAAACAAGCTCATTTTGTGGG
AT
CCAGACCGCTACGGCACCACGGTGCCCTACACATCACGGAGGCCCAAGGACTCAGAACGGGAGGGGCA
G
GGCTACAGCTTTGTGTCCCGTGGGGAGATGGAGGCTGACATCCGAGCCGGGCGCTACCTAGAACATGGC
GAG
TATGAGGGCAACCTGTATGGCACACGGATCGACTCCATCCGGGGCGTTGTTGCCTCTGGCAAGGTGT
GC
GTGCTGGATGTCAACCCGCAGGCGGTGAAGGTCCTGAGGACAGCTGAGTTTGTCCCTTACGTGGTGTT
C
ATAGAGGCTCCTGATTATGAGACTCTACGGGCCATGAACCGGGCTGCGCTGGAGAGTGGCGTGTCCACT
AAG
CAGTTGACGGAGGCAGATCTGAGGCGGACAGTGGAGGAGAGCAGCCGCATCCAGAGGGGCTATGGGC
AT
TACTTCGACCTCAGCCTGGTCAACAGCAACCTGGAGAGGACCTTCCGTGAGCTCCAGACTGCCATGGA
G
AAACTTCGCACGGAGCCCCAGTGGGTGCCTGTGAGCTGGGTGTACTGA


Translation (552 aa):
MPVAATNSESAMQQVLDNLGSLPNATGAAELDLIFLRGIMESPIVRSLAKAHERLEETKLEAVRDNNLEL
V
QEILRDLAELAEQSSTAAELARILQEPHFQ
SLLETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRM
V
GIRKTAGEHL
GVTFRVEGGELVIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRSASGS
V
ILKILPSYQEPHLPRQ
VFVKCHFDYDPARDSLSPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEGGSA
G
LIPSQLLEEKRKAFVKRDLELTPTS
GTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYEEVARMPPFRR
K
TLVLIGAQGVGRRSLKNKLILWDPDRYGTTVP
YTSRRPKDSEREGQGYSFVSRGEMEADIRAGRYLEHG
E
YEGNLYGTRIDSIRGVVASGKVCVLDVNPQ
AVKVLRTAEFVPYVVFIEAPDYETLRAMNRAALESGVST
K
QLT
EADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser