NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS25289.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25289.1 Public Mus musculus 11 Atp5g1 23 108 98 CCDS HistoryNCBI Gene:11951Re-query CCDS DB by CCDS ID:25289.1Re-query CCDS DB by GeneID:11951See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25289.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000090541.11 ENSMUSP00000088029.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000090541.11Link to Ensembl Protein Viewer:ENSMUSP00000088029.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000090541Re-query CCDS DB by Protein ID:ENSMUSP00000088029
Original member Current member EBI ENSMUST00000107684.1 ENSMUSP00000103312.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107684.1Link to Ensembl Protein Viewer:ENSMUSP00000103312.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000107684Re-query CCDS DB by Protein ID:ENSMUSP00000103312
Original member Current member EBI ENSMUST00000107686.7 ENSMUSP00000103314.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107686.7Link to Ensembl Protein Viewer:ENSMUSP00000103314.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000107686Re-query CCDS DB by Protein ID:ENSMUSP00000103314
Original member Current member EBI ENSMUST00000178611.7 ENSMUSP00000137633.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178611.7Link to Ensembl Protein Viewer:ENSMUSP00000137633.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000178611Re-query CCDS DB by Protein ID:ENSMUSP00000137633
Original member Current member NCBI NM_001161419.1 NP_001154891.1 Accepted alive Link to Nucleotide Sequence:NM_001161419.1Link to Protein Sequence:NP_001154891.1Re-query CCDS DB by Nucleotide ID:NM_001161419Re-query CCDS DB by Protein ID:NP_001154891Link to BLAST:NP_001154891.1
Original member Current member NCBI NM_007506.6 NP_031532.2 Accepted alive Link to Nucleotide Sequence:NM_007506.6Link to Protein Sequence:NP_031532.2Re-query CCDS DB by Nucleotide ID:NM_007506Re-query CCDS DB by Protein ID:NP_031532Link to BLAST:NP_031532.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001154891.1 136 Q9CR84 136 100% 0 0
NP_031532.2 136 Q9CR84 136 100% 0 0

Chromosomal Locations for CCDS 25289.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 96073104 96073218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 96073523 96073701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 96073962 96074039 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 96074987 96075025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (411 nt):
ATGCAGACCACCAAGGCACTGCTCATTTCTCCAGCTCTGATTCGCTCCTGTACCAGGGGTCTAATCAGGC
CT
GTGTCTGCCTCCCTCCTGAGCAGACCAGAGGCCCCATCTAAGCAGCCTTCCTGCAGCAGCTCCCCTCT
C
CAGGTGGCCCGACGGGAATTCCAGACCAGTGTCATTTCCCGGGACATCGACACAGCAGCCAAGTTCATT
GGT
GCTGGGGCCGCCACAGTTGGTGTGGCTGGATCAGGAGCTGGCATTGGCACAGTGTTTGGTAGCTTGA
TT
ATTGGCTATGCCAGGAACCCATCTCTCAAGCAGCAGCTCTTCTCCTATGCCATTCTGGGGTTTGCCCT
G
TCTGAGGCCATGGGACTCTTCTGTTTGATGGTCGCCTTCCTCATCCTCTTCGCCATGTGA


Translation (136 aa):
MQTTKALLISPALIRSCTRGLIRPVSASLLSRPEAPSKQPSCSSSPLQVARREFQTSVISRDIDTAAKFI
G
AGAATVGVAGSGAGIGTVFGSLIIGYA
RNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser