NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS25158.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25158.1 Public Mus musculus 11 Slfn4 21 106 86 CCDS HistoryNCBI Gene:20558Re-query CCDS DB by CCDS ID:25158.1Re-query CCDS DB by GeneID:20558See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25158.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000000208 ENSMUSP00000000208 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000208Link to Ensembl Protein Viewer:ENSMUSP00000000208Re-query CCDS DB by Nucleotide ID:ENSMUST00000000208Re-query CCDS DB by Protein ID:ENSMUSP00000000208
Original member Current member EBI,WTSI ENSMUST00000167596 ENSMUSP00000132595 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000167596Link to Ensembl Protein Viewer:ENSMUSP00000132595Re-query CCDS DB by Nucleotide ID:ENSMUST00000167596Re-query CCDS DB by Protein ID:ENSMUSP00000132595
Original member Current member EBI,WTSI OTTMUST00000001790 OTTMUSP00000000857 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000001790Link to Vega Protein Viewer:OTTMUSP00000000857Re-query CCDS DB by Nucleotide ID:OTTMUST00000001790Re-query CCDS DB by Protein ID:OTTMUSP00000000857
Original member Current member NCBI NM_001302559.1 NP_001289488.1 Accepted alive Link to Nucleotide Sequence:NM_001302559.1Link to Protein Sequence:NP_001289488.1Re-query CCDS DB by Nucleotide ID:NM_001302559Re-query CCDS DB by Protein ID:NP_001289488Link to BLAST:NP_001289488.1
Original member Current member NCBI NM_011410.3 NP_035540.2 Accepted alive Link to Nucleotide Sequence:NM_011410.3Link to Protein Sequence:NP_035540.2Re-query CCDS DB by Nucleotide ID:NM_011410Re-query CCDS DB by Protein ID:NP_035540Link to BLAST:NP_035540.2

Chromosomal Locations for CCDS 25158.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 83185310 83185446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 83186525 83187564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 83188663 83189294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1809 nt):
ATGGCTGGAAACACCCCACAGCTGGAGAAAGATGTGAATCCACAGACATCCATAGAGCCCTCTGTTCAAG
TC
AAGTGTCCAGGGGATATTCTTCAGGGAGGACGGCATGCCAAGCGAGGAAGATGGATGGCGTCGTGGAA
A
GGATTTCATCTGGGAAGGAGAGACAGTGACTGCAAAATGAACATCACTGTCGATCAGGACACGGACTAC
GCT
GAACTGGTTCTGTCTGTAGGAGAAATCACACTCGGAGAGAAGACTAGGGATTCAATGAAAGATAGCC
AA
CTGAGAAGAAAAGAAGCCAAAAGTATATTACAGGCTGTGTGCACCCTGCTGAATTCTGGAGGGGGTGT
G
GTCAAGGCTCACATTAAAAATCAAAACTACAGCTTCACCAGAGATGGAATGGGACTGGATTTGGTAAAT
CCC
TTGCCTGGTATCCTGCACCTTCCTCATGACTATCTAGACTTCATGCAGTACAACGACTACTTTTTCG
TT
TTTGTGAAACCATGGAAGCCGAATCAGAGAGGTCCGGGGATCGCCACCTGGAAAACCAACTTGTACAA
G
AGAATCTTCTCATTCTCAGTTGAACTGAAAGCAGCGGATGCAGTGCAGTTCCTCAAATCCAGACCAAGT
TCC
CATGGAAAAACAGTCTGTAATGAAACACTAAATGAATGTCTTTCCTTATTTAACAGAGACTGGCTTG
CC
TATGAGGAGACATTCTGTTTCACTAAATCCACACATGCTGAAGTAAAATTGACTCCTAAGGAAAAGAT
T
TCTCCTAAGGAAAAGATTTTAGAGCTCCTCCCTCAAACTGTTTCTGCATTTGCAAACACTGATGGGGGA
TAT
TTGTTCATTGGCTTGGATGGCAAAACGCAGCAAATTATTGGTTTTGAAGCAGAGAAGAGCGATCTCG
TG
CTTCTAGAGAGTGAAATAGAAAAGTGCATCCAACAGCTGCCTGTCACTCACTTCTGTGAGGAGAAGGA
G
AAGATCAAGTACACGTGCAAATTCATCGAAGTGCACAAATCCGGAGCTGTGTGTGCATATGTGTGCGCG
ATC
AGAGTGGAGAAGTTCTGCTGTGCAGTGTTCGCTGCAGAGCCTGAGTCCTGGCACGTGGAAGGCAGCT
GT
GTGAAGAGGTTTACCACAGAGGAATGGGTGAAGCGCCAGATGGATGCCACTGCAGTGATGCCTGGAAA
G
GTGATATGCTCTCCAGAAGCCCTCTGCATGAAACCATTCTCACAACATGAAGGCTATGAGCAGTTAGTC
CGG
ACAGAATTGGGCTCCCTGCGTAAAGGAACACTGGTTGTCTCCAAGAGCTGGGCTTTGGATCTGGGCT
TG
CAAGAGAAGCAGGAAGTTATCTGGGATGTGCTTCATATTTCCCAGGGCAGTCTCCTGACCCTGCATGT
C
TTTGTCCAGGGAGATGAGAACCTGGAAGGCAACAGCAGTCTTCTTGGGAAACTAGGCGCCGAGTTAAAG
GGC
TATTATAAACAAATTGCCCTAACATTAAAGCAGACGTTGGTAAACCATTGTGGTTACACTGCGAAAA
TA
GGTATTATAGTAAAGATAACATACTTGGGTCATAAGACAATGTGTCTTTATGACTCAAGCGCGAAAAT
A
TGTTACCCCCAAATATATTATCTGACTACCAAGGCAGTAAAGGACTTAGAAAAAGCTCTCGCTGAAATC
TTA
GGAAGTTATGAGTCTTTCTACAGTTTACCCAGGAGAAACTGGGATTCTTTTATGTCTGCGTTTTTAA
AT
GTGGGCAGTTATATAGTTTACTTTTCGAGAAATGTCTTAACTCATATTCGAATCTGA


Translation (602 aa):
MAGNTPQLEKDVNPQTSIEPSVQVKCPGDILQGGRHAKRGRWMASWKGFHLGRRDSDCKMNITVDQDTDY
A
ELVLSVGEITLGEKTRDSMKDSQLRRKEAKSILQAVCTLLNSGGGVVKAHIKNQNYSFTRDGMGLDLVN
P
LPGILHLPHDYLDFMQYNDYFFVFVKPWKPNQRGPGIATWKTNLYKRIFSFSVELKAADAVQFLKSRPS
S
HGKTVCNETLNECLSLFNRDWLAYEETFCFTKSTHAEVKLTPKEKISPKEKILELLPQTVSAFANTDGG
Y
LFIGLDGKTQQIIGFEAEKSDLVLLESEIEKCIQQLPVTHFCEEKEKIKYTCKFIEVHKSGAVCAYVCA
I
RVEKFCCAVFAAEPESWHVEGSCVKRFTTEEWVKRQMDATA
VMPGKVICSPEALCMKPFSQHEGYEQLV
R
TELGSLRKGTLVVSKSWALDLGLQEKQEVIWDVLHISQGSLLTLHVFVQGDENLEGNSSLLGKLGAELK
G
YYKQIALTLKQTLVNHCGYTAKIGIIVKITYLGHKTMCLYDSSAKICYPQIYYLTTKAVKDLEKALAEI
L
GSYESFYSLPRRNWDSFMSAFLNVGSYIVYFSRNVLTHIRI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser