NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24807.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24807.1 Public Mus musculus 11 Usp22 23 108 98 CCDS HistoryNCBI Gene:216825Re-query CCDS DB by CCDS ID:24807.1Re-query CCDS DB by GeneID:216825See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24807.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000041683.8 ENSMUSP00000041263.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041683.8Link to Ensembl Protein Viewer:ENSMUSP00000041263.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000041683Re-query CCDS DB by Protein ID:ENSMUSP00000041263
Original member Current member NCBI NM_001004143.4 NP_001004143.2 Accepted alive Link to Nucleotide Sequence:NM_001004143.4Link to Protein Sequence:NP_001004143.2Re-query CCDS DB by Nucleotide ID:NM_001004143Re-query CCDS DB by Protein ID:NP_001004143Link to BLAST:NP_001004143.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001004143.2 525 Q5DU02 525 100% 0 0

Chromosomal Locations for CCDS 24807.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 61154471 61154513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61155180 61155329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61155768 61155830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61157171 61157262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61158292 61158418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61159205 61159363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61160572 61160677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61161314 61161461 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61162827 61162996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61163726 61163827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61166671 61166784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61168260 61168392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61174715 61174885 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1578 nt):
ATGGTGGCCAGGCCGGAGCCTGAGGTCGAGGCCATGGACGCTGAGCTGGCGGTACCGCCGCCTGGCTGCT
CG
CACCTGGGCAGCTTCAAGGTGGACAACTGGAAGCAAAACCTGCGGGCCATCTACCAGTGCTTCGTGTG
G
AGCGGAACTGCCGAGGCTCGCAAGCGCAAGGCAAAGTCCTGTGTCTGCCATGTCTGCGGCATCCACCTG
AAC
CGGCTGCACTCTTGCCTCTACTGTGTCTTCTTTGGCTGTTTCACGAAGAAGCACATCCATGACCATG
CC
AAGTCAAAGCGACACAACCTGGCCATCGACCTGATGTACGGAGGTATTTACTGCTTCTTGTGTCAGGA
C
TACATCTATGACAAAGACATAGAAATCATTGCCAAAGAGGAGCAGCGCAAGGCTTGGAAGATGCAAGGT
GTT
GGAGAGAAGTTTTCAACTTGGGAACCAACTAAACGGGAGCTGGAACTGCTGAAGCATAACCCAAAGA
GG
CGGAAGATCACCTCCAATTGTACCATAGGTCTGCGTGGACTGATCAACCTGGGGAACACGTGTTTCAT
G
AACTGCATCGTGCAGGCGCTGACCCACACTCCGCTCCTGAGAGACTTCTTTCTGTCGGATAGGCACCGC
TGT
GAGATGCAGAGCCCCAGCTCCTGCTTGGTCTGTGAGATGTCCTCTCTCTTCCAGGAGTTTTACTCAG
GG
CACCGCTCCCCACACATTCCATACAAGCTGCTGCACCTGGTGTGGACGCACGCCCGGCACCTGGCGGG
T
TATGAGCAGCAGGACGCACATGAGTTCCTCATTGCAGCCCTGGACGTCCTCCACCGGCACTGCAAAGGT
GAT
GACAATGGGAAGAAAGCCAACAATCCTAACCACTGCAATTGCATCATTGACCAGATCTTTACGGGTG
GG
CTCCAGTCTGATGTTACATGCCAAGTCTGCCACGGGGTCTCCACCACCATAGACCCCTTCTGGGACAT
C
AGTTTAGACCTTCCCGGTTCTTCTACCCCATTCTGGCCCTTGAGCCCAGGGAGCGAGGGCAGTGTGGTT
AAT
GGGGAGAGCCATGCATCCGGGACCACCACTCTCACAGACTGCCTGCGAAGATTTACCAGACCAGAGC
AC
TTAGGAAGCAGTGCCAAGATCAAGTGTAGCGGTTGCCATAGCTACCAAGAGTCCACAAAGCAGCTCAC
C
ATGAAGAAGCTGCCCATTGTGGCCTGTTTCCATCTCAAACGATTTGAACACTCAGCCAAACTTCGGCGG
AAG
ATCACCACATATGTGTCTTTTCCCCTGGAACTGGACATGACGCCCTTCATGGCCTCCAGCAAAGAGA
GC
AGGATGAATGGGCAATACCAGCAGCCCCTGGACAGTCTCAACAATGACAACAAATACTCCCTGTTTGC
T
GTCGTTAACCATCAAGGGACCTTGGAGAGTGGCCACTACACCAGCTTCATCCGGCAGCACAAAGACCAG
TGG
TTCAAGTGTGATGACGCCATTATCACCAAGGCCAGCATCAAAGATGTACTGGACAGTGAAGGGTACC
TA
CTCTTCTATCACAAACAGTTCCTGGAATACGAGTAG


Translation (525 aa):
MVARPEPEVEAMDAELAVPPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKSCVCHVCGIHL
N
RLHSCLYCVFFGCFTKKHIHDHAKSKRHNL
AIDLMYGGIYCFLCQDYIYDKDIEIIAKEEQRKAWKMQG
V
GEKFSTWEPTKRELELLKHNPKRRKITSNCTI
GLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHR
C
EMQSPSSCLVCEMSSLFQE
FYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKG
D
DNGKKANNPNHCNCIIDQIFTGGLQSDVTCQVC
HGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGSVV
N
GESHASGTTTLTDCLR
RFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR
K
ITTYVSFPLELDMTPFMAS
SKESRMNGQYQQPLDSLNNDNKYSLFAVVNHQGTLESGHYTSFIRQHKDQ
W
FKCDDAIITKASIKDVLDSE
GYLLFYHKQFLEYE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser