NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24791.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24791.1 Public Mus musculus 11 Drg2 21 106 86 CCDS HistoryNCBI Gene:13495Re-query CCDS DB by CCDS ID:24791.1Re-query CCDS DB by GeneID:13495See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24791.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000018568 ENSMUSP00000018568 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000018568Link to Ensembl Protein Viewer:ENSMUSP00000018568Re-query CCDS DB by Nucleotide ID:ENSMUST00000018568Re-query CCDS DB by Protein ID:ENSMUSP00000018568
Original member Current member EBI,WTSI OTTMUST00000012891 OTTMUSP00000005996 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012891Link to Vega Protein Viewer:OTTMUSP00000005996Re-query CCDS DB by Nucleotide ID:OTTMUST00000012891Re-query CCDS DB by Protein ID:OTTMUSP00000005996
Original member NCBI NM_021354.1 NP_067329.1 Updated not alive Link to Nucleotide Sequence:NM_021354.1Link to Protein Sequence:NP_067329.1Re-query CCDS DB by Nucleotide ID:NM_021354Re-query CCDS DB by Protein ID:NP_067329
Current member NCBI NM_021354.2 NP_067329.1 Accepted alive Link to Nucleotide Sequence:NM_021354.2Link to Protein Sequence:NP_067329.1Re-query CCDS DB by Nucleotide ID:NM_021354Re-query CCDS DB by Protein ID:NP_067329Link to BLAST:NP_067329.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067329.1 364 Q9QXB9 364 100% 0 0

Chromosomal Locations for CCDS 24791.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 60454680 60454743 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60456551 60456711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60459442 60459531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60460028 60460088 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60460787 60460877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60461322 60461394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60461514 60461604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60462174 60462271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60462558 60462634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60464134 60464222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60464833 60464891 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60467685 60467738 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60468064 60468150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1095 nt):
ATGGGGATCTTGGAGAAAATCTCGGAGATCGAGAAGGAGATCGCTCGAACGCAGAAGAACAAGGCCACCG
AG
TACCACCTGGGCCTGCTGAAAGCAAAACTGGCCAAGTATCGGGCCCAGCTCCTGGAACCATCCAAATC
C
GCCTCATCCAAAGGAGAGGGCTTTGATGTCATGAAGTCAGGTGATGCCCGTGTGGCACTGATTGGCTTT
CCC
TCTGTGGGTAAGTCCACCTTCTTGAGTCTGATGACCTCTACAGCCAGCGAAGCTGCGTCCTATGAGT
TT
ACCACCCTGACGTGCATCCCTGGGGTCATTGAATACAAAGGTGCCAACATCCAGCTCTTGGACCTTCC
T
GGAATCATTGAAGGAGCAGCACAAGGCCGAGGCCGTGGCCGGCAGGTGATTGCCGTAGCACGCACAGCT
GAT
GTCGTCGTCATGATGCTGGATGCCACCAAGGGAGATGTGCAGAGGTCCCTGCTGGAGAAGGAGCTGG
AG
TCTGTGGGTATTCGCCTGAACAAGCATAAGCCCAACATCTATTTCAAGCCCAAGAAAGGTGGTGGCAT
C
TCCTTTAACTCAACAGTCACACTGACACAATGCTCTGAGAAGCTGGTGCAGCTCATCCTACATGAATAC
A
AG
ATCTTCAACGCCGAGGTACTCTTCCGAGAAGACTGCTCTCCAGACGACTTCATCGATGTGATTGTGG
GC
AACCGGGTGTATATGCCCTGCCTCTATGTGTATAACAAAATCGACCAGATCTCCATGGAAGAAGTAGA
C
CGTTTAGCTCGAAAGCCCAACAGTGTAGTTATCAGTTGCGGTATGAAGTTGAACCTCGACTACCTGCTG
GAG
ATGCTGTGGGAGTACCTGGCCCTCACCTGCATTTACACCAAGAAGAGAGGACAGAGACCGGACTTCA
CA
GACGCCATCATTCTCCGGAAAGGGGCCTCTGTTGAACACGTGTGCCACCGCATCCATCGGTCACTGGC
C
AGCCAGTTCAAGTACGCCTTGGTGTGGGGTACCAGCACCAAGTACAGCCCACAGCGGGTAGGCCTGACC
CAC
ACTATGGAGCATGAGGACGTCATCCAGATTGTGAAGAAGTAG


Translation (364 aa):
MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASSKGEGFDVMKSGDARVALIGF
P
SVGK
STFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIEGAAQGRGRGRQVIAVARTA
D
VVVMMLDATKGDVQ
RSLLEKELESVGIRLNKHKPNIYFKPKKGGGISFNSTVTLTQCSEKLVQLILHEY
K
IFNAEVLFREDCSPDDFIDVIVGNRVYMPCLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLL
E
MLWEYLALTCIYTKKRG
QRPDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLT
H
TMEHEDVIQIVKK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser