NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24428.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24428.1 Public Mus musculus 11 Igfbp3 21 106 86 CCDS HistoryNCBI Gene:16009Re-query CCDS DB by CCDS ID:24428.1Re-query CCDS DB by GeneID:16009See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24428.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020702 ENSMUSP00000020702 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020702Link to Ensembl Protein Viewer:ENSMUSP00000020702Re-query CCDS DB by Nucleotide ID:ENSMUST00000020702Re-query CCDS DB by Protein ID:ENSMUSP00000020702
Original member Current member EBI,WTSI ENSMUST00000135887 ENSMUSP00000131670 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000135887Link to Ensembl Protein Viewer:ENSMUSP00000131670Re-query CCDS DB by Nucleotide ID:ENSMUST00000135887Re-query CCDS DB by Protein ID:ENSMUSP00000131670
Original member Current member EBI,WTSI OTTMUST00000011487 OTTMUSP00000005343 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011487Link to Vega Protein Viewer:OTTMUSP00000005343Re-query CCDS DB by Nucleotide ID:OTTMUST00000011487Re-query CCDS DB by Protein ID:OTTMUSP00000005343
Original member Current member EBI,WTSI OTTMUST00000011488 OTTMUSP00000049576 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011488Link to Vega Protein Viewer:OTTMUSP00000049576Re-query CCDS DB by Nucleotide ID:OTTMUST00000011488Re-query CCDS DB by Protein ID:OTTMUSP00000049576
Original member Current member NCBI NM_008343.2 NP_032369.2 Accepted alive Link to Nucleotide Sequence:NM_008343.2Link to Protein Sequence:NP_032369.2Re-query CCDS DB by Nucleotide ID:NM_008343Re-query CCDS DB by Protein ID:NP_032369Link to BLAST:NP_032369.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032369.2 292 P47878 292 100% 0 0

Chromosomal Locations for CCDS 24428.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 7208383 7208508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 7209459 7209578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 7210019 7210245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 7213385 7213790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (879 nt):
ATGCATCCCGCGCGCCCCGCGCTCTGGGCGGCTGCGCTCACTGCCCTCACTCTGCTCCGCGGACCGCCGG
TG
GCGCGAGCTGGCGCGGGCGCGGTGGGCGCGGGCCCCGTGGTGCGCTGCGAACCGTGCGACGCGCGTGC
G
CTGTCCCAGTGCGCGCCTCCGCCCACCGCGCCCGCGTGCACGGAGCTGGTGCGAGAGCCCGGCTGCGGC
TGC
TGCCTGACTTGCGCGCTGCGCGAAGGCGACGCGTGCGGCGTCTACACGGAGCGCTGTGGCACCGGCC
TC
CGCTGCCAGCCGCGGCCCGCGGAGCAGTACCCGCTGAGGGCGCTGCTGAATGGCCGCGGGTTCTGCGC
C
AACGCCAGCGCTGCAGGCAGCCTAAGCACCTACCTCCCCTCCCAACCTGCTCCAGGAAACATCAGTGAG
TCC
GAGGAGGAGCACAATGCTGGGAGTGTGGAAAGCCAGGTTGTCCCCAGCACACACCGAGTGACCGATT
CC
AAGTTCCATCCACTCCATGCCAAGATGGATGTCATCAAAAAAGGCCACGCCAGGGACAGCCAGCGCTA
C
AAAGTTGACTATGAGTCTCAAAGCACAGACACCCAGAACTTCTCCTCCGAGTCTAAGCGGGAGACAGAA
TAC
GGTCCCTGCCGCAGAGAAATGGAGGACACACTGAATCATCTGAAGTTCCTCAATGTGCTGAGTCCCA
GA
GGCGTCCACATCCCAAACTGTGACAAGAAGGGGTTCTATAAGAAGAAGCAGTGCCGCCCTTCCAAAGG
C
AGAAAGCGGGGCTTCTGCTGGTGTGTGGACAAGTATGGGCAGCCCTTGCCAGGCTACGACACCAAGGGG
AAA
GACGACGTACATTGCCTCAGCGTGCAGAGCCAGTAG


Translation (292 aa):
MHPARPALWAAALTALTLLRGPPVARAGAGAVGAGPVVRCEPCDARALSQCAPPPTAPACTELVREPGCG
C
CLTCALREGDACGVYTERCGTGLRCQPRPAEQYPLRALLNGRGFCANASAAGSLSTYLPSQPAP
GNISE
S
EEEHNAGSVESQVVPSTHRVTDSKFHPLHAKMDVIKKGHARDSQRYKVDYESQSTDTQNFSSESKRETE
Y
GPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYDTKG
K
DDVHCLSVQSQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser