NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, October 16, 2019, starting at 8:00 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24421.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24421.1 Public Mus musculus 11 Myo1g 21 106 86 CCDS HistoryNCBI Gene:246177Re-query CCDS DB by CCDS ID:24421.1Re-query CCDS DB by GeneID:246177See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24421.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000003459 ENSMUSP00000003459 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000003459Link to Ensembl Protein Viewer:ENSMUSP00000003459Re-query CCDS DB by Nucleotide ID:ENSMUST00000003459Re-query CCDS DB by Protein ID:ENSMUSP00000003459
Original member Current member EBI,WTSI OTTMUST00000011450 OTTMUSP00000005332 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011450Link to Vega Protein Viewer:OTTMUSP00000005332Re-query CCDS DB by Nucleotide ID:OTTMUST00000011450Re-query CCDS DB by Protein ID:OTTMUSP00000005332
Original member Current member NCBI NM_178440.4 NP_848534.2 Accepted alive Link to Nucleotide Sequence:NM_178440.4Link to Protein Sequence:NP_848534.2Re-query CCDS DB by Nucleotide ID:NM_178440Re-query CCDS DB by Protein ID:NP_848534Link to BLAST:NP_848534.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_848534.2 1024 Q5SUA5 1024 100% 0 0

Chromosomal Locations for CCDS 24421.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 6506676 6506832 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6506907 6507061 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6507869 6507982 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6508190 6508294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6509325 6509469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6510148 6510371 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6510868 6511075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6511483 6511649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6512161 6512293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6512463 6512537 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6514467 6514537 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6514752 6514922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6515094 6515208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6515849 6515994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6516079 6516303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6516748 6516864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6517087 6517197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6517570 6517623 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6517852 6518017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6518734 6518827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6518979 6519187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6520742 6520854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3075 nt):
ATGCTTGCAGTGGGCAGGATGGAGGACGAAGAAGGCCCTGAGTATGGGAAACCAGACTTCGTGCTTTTGG
AT
CAACTGACCATGGAGGACTTCATGAAGAACCTAGAGCTCAGGTTTGAGAAGGGCCGTATCTATACCTA
C
ATTGGTGAGGTGCTCGTATCCGTGAACCCCTACCAGGAACTGCCATTGTATGGGCCAGAGGCCATTGCC
AAG
TACCAGGGCCGCGAGCTCTATGAGCGACCACCTCATCTTTACGCCGTGGCCAATGCTGCTTACAAGG
CA
ATGAAGCGCAGATCCAGGGACACCTGCATCGTCATCTCAGGGGAGAGTGGGGCAGGGAAGACAGAAGC
C
AGCAAGCACATCATGCAGTACATTGCTGCTGTCACCAACCCAAGCCAGAGGGCTGAGGTGGAGAGGGTG
AAG
AATGTGCTCCTCAAGTCCACCTGTGTGCTCGAAGCCTTTGGCAATGCCCGCACCAATCGCAACCACA
AC
TCCAGCCGCTTTGGCAAGTACATGGACATCAACTTCGACTTCAAGGGGGATCCTGTTGGTGGACACAT
C
CACAGCTACCTGCTGGAGAAGTCTAGGGTTCTCAAGCAACATGTAGGTGAGAGGAACTTCCATGCCTTC
TAC
CAGTTGCTTCGAGGCAGTGAGGACCAAGAGCTGCAAGGACTGCATCTGGAAAGAAATCCTGCTGTGT
AT
AATTTCACGCGTCAGGGAGCTGGGCTCAACATGGGTGTGCACAATGCCTTGGACAGTGATGAGAAGAG
C
CACCAAGGAGTGATGGAGGCCATGAGGATCATCGGCTTCAGTCCTGACGAGGTGGAGTCCATCCATCGC
ATC
CTTGCCGCCATATTACACCTGGGAAACATCGAGTTTGTGGAGACAGAGGAAAATGGACCACAGAAAG
GA
GGCCTGGAAGTGGCTGATGAGGCCCTGGTAGGATATGTGGCCAAGCTGACAGCCACTCCCAGAGACCT
T
GTTCTGCGAACCCTGCTGGCTCGAACAGTGGCTTCAGGAGGCCGAGAAGTCATTGAGAAGAGCCACACC
GTG
GCTGAGGCCAGCTATGCCCGGGATGCCTGTGCAAAGGCGATGTACCAGCGACTGTTTGAGTGGGTTG
TG
AACAAGATCAATAGCATCATGGAACCCCGAAACCGAGACCCTCGGTGTGATGGCAAGGATACTGTCAT
T
GGGGTGCTGGACATTTACGGCTTTGAGGTGTTCCCTGTCAACAGCTTTGAGCAGTTCTGCATCAACTAC
TGC
AACGAGAAGCTGCAGCAGCTCTTTATCCAGCTTATCCTGAAGCAAGAGCAGGAGGAGTATGAGCGAG
AG
GGCATCGCCTGGCAGACCATCGAGTACTTCAACAACGCTACCATTGTGGAACTTGTAGAGCAGCCCCA
C
AGAGGCATCCTGGCTGTGTTAGATGAAGCCTGCAGCACGGCAGGCCCCATCACTGACCGAATCTTCCTG
CAG
ACCCTGGACACACACCACCGCCACCACCCACACTATTCCAGCCGCCAGCTTTGCCCTACGGACAAGA
CC
ATGGAGTTTGGCCGAGACTTCCAGATCAAACACTATGCAGGCGATGTCACGTACTCTGTGGAAGGCTT
C
ATTGACAAGAATAGAGACTCTCTCTTCCAGGACTTCAAACGGCTGCTGTACAATAGTGTGGATCCCACC
TTG
CGAGCCATGTGGCCTGACGGGCAACAGGACATCACGGAAGTGACCAAGCGTCCCCTGACAGCCGGCA
CA
CTCTTTAAGAATTCCATGGTTGCCCTGGTGGAAAACTTGGCTTCCAAGGAACCCTTCTATGTCCGCTG
C
ATCAAACCCAACGAAGACAAGGTGGCTGGGCGGCTCGATGAAGCCCACTGTCGTCACCAGGTCGAATAC
CTG
GGACTATTGGAGAATGTGAGGGTCCGCAGGGCTGGCTTTGCTTCCCGGCAGCCCTACCCTCGATTCC
TG
CTCAGGTACAAGATGACCTGTGAGTACACGTGGCCCAACCACCTGCTGGGCTCTGACCGGGATGCGGT
G
AGCGCCCTGCTGGAACAGCATGGGCTGCAAGGGGATGTGGCCTTTGGCCACAGCAAGCTGTTCATCCGA
TCC
CCAAGGACGCTGGTCACTCTGGAGCAGAGCCGAGCTCGCCTGATTCCCATCATTGTGTTATTGCTGC
AG
AAGGCTTGGCGGGGCACCCTGGCTAGGTGGCACTGCCGGCGACTAAGGGCCATCTACACCATCATGCG
C
TGGTTCCGGAGGCACAAGGTGCGTGCTCACCTGATTGAACTACAGCGCCGGTTCCAGGCTGCACGGCAG
CCC
CCACTCTATGGCCGTGACCTTGTGTGGCCCACACCTCCTGCTGTGCTGCAGCCCTTCCAGGACACTT
GC
CGTGTTCTCTTCAGCAGGTGGCGGGCACGGCAGTTAGTGAAGAACATCCCTCCTTCAGACATGATCCA
G
ATCAAGGCCAAGGTGGCTGCTATGGGGGCCTTGCAAGGATTGCGGCAGGACTGGGGTTGCCAGCGGGCC
TGG
GCCCGAGACTACCTGTCCTCTGACACTGACAACCCCACAGCTTCCCATCTGTTTGCTGAGCAACTAA
AG
GCACTTCGGGAGAAAGATGGCTTTGGCTCTGTGCTTTTCTCCAGCCATGTGCGCAAGGTGAATCGCTT
C
CGCAAGAGCCGGGACCGGGCCCTTCTGCTCACAGATCGGTATCTGTACAAGCTGGAGCCTGGACGACAG
TAC
CGGGTGATGCGGGCTGTGCCTCTGGAGGCGGTGACAGGGCTGAGTGTGACCAGTGGAAGAGATCAGC
TG
GTGGTGTTACATGCCCAAGGCTATGATGATCTTGTAGTGTGTCTACACCGTTCCCAACCACCACTGGA
C
AATCGAATTGGGGAGCTGGTGGGCATGCTGGCTGCACACTGCCAGGGAGAGGGACGAACTCTGGAGGTC
CGT
GTCTCTGACTGCATCCCACTGAGCCAGCGTGGTGCCCGGCGCCTCATTTCTGTGGAGCCCAGGCCAG
AG
CAGCCTGAGCCAGATTTCCAAAGCAGCCGTAGCACCTTTACCCTCCTCTGGCCAAGCCACTGA


Translation (1024 aa):
MLAVGRMEDEEGPEYGKPDFVLLDQLTMEDFMKNLELRFEKGRIYTYIGEVLVSVNPYQELPLYGPEAIA
K
YQGRELYERPPHLYAVANAAYKAMKRRSRDTCIVIS
GESGAGKTEASKHIMQYIAAVTNPSQRAEVERV
K
NVLLKSTCVLEAFGNARTNRNHNSSRFGKYMDINFDFKGDPVGGHIHSYLLEK
SRVLKQHVGERNFHAF
Y
Q
LLRGSEDQELQGLHLERNPAVYNFTRQGAGLNMGVHNALDSDEKSHQGVMEAMRIIGFSPDEVESIHR
I
LAAILHL
GNIEFVETEENGPQKGGLEVADEALVGYVAKLTATPRDLVLRTLLARTVASGGREVIEKSHT
V
AEASYARDACAK
AMYQRLFEWVVNKINSIMEPRNRDPRCDGKDTVIGVLDIYGFEVFPVNSFEQFCINY
C
NEKLQQLFIQLILKQEQEEYEREGIAWQT
IEYFNNATIVELVEQPHRGILAVLDEACSTAGPITDRIFL
Q
TLDTHHRHHPHYSSRQ
LCPTDKTMEFGRDFQIKHYAGDVTYSVEGFIDKNRDSLFQDFKRLLYNSVDPT
L
RAMWPDGQQDITEVTKRPLTAGTLFKNSMVALVENLASK
EPFYVRCIKPNEDKVAGRLDEAHCRHQVEY
L
GLLENVRVRRAGFASRQPYPRFLL
RYKMTCEYTWPNHLLGSDRDAVSALLEQHGLQGDVAFGHSKLFIR
S
PRTLVTLEQSRARLIPIIVLLLQK
AWRGTLARWHCRRLRAIYTIMRWFRRHKVRAHLIELQRRFQAARQ
P
PLYGRDLVWPTPPAVLQPFQDTCRVLFS
RWRARQLVKNIPPSDMIQIKAKVAAMGALQGLRQDWGCQRA
W
ARDYLSS
DTDNPTASHLFAEQLKALREKDGFGSVLFSSHVRKVNRFRKSRDRALLLTDRYLYKLEPGRQ
Y
RVMRAVPLEA
VTGLSVTSGRDQLVVLHAQGYDDLVVCLHRSQPPLDNRIGELVGMLAAHCQGEGRTLEV
R
VSDCIPLSQRGARRLISVEPRPEQPEPDFQSSRSTFTLLWPSH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser