NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS2441.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2441.1 Public Homo sapiens 2 GMPPA 22 109 92 CCDS HistoryNCBI Gene:29926Re-query CCDS DB by CCDS ID:2441.1Re-query CCDS DB by GeneID:29926See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2441.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000313597.9 ENSP00000315925.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000313597.9Link to Ensembl Protein Viewer:ENSP00000315925.5Re-query CCDS DB by Nucleotide ID:ENST00000313597Re-query CCDS DB by Protein ID:ENSP00000315925
Original member Current member EBI ENST00000341142.7 ENSP00000340760.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000341142.7Link to Ensembl Protein Viewer:ENSP00000340760.3Re-query CCDS DB by Nucleotide ID:ENST00000341142Re-query CCDS DB by Protein ID:ENSP00000340760
Original member Current member EBI ENST00000358215.8 ENSP00000350949.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000358215.8Link to Ensembl Protein Viewer:ENSP00000350949.3Re-query CCDS DB by Nucleotide ID:ENST00000358215Re-query CCDS DB by Protein ID:ENSP00000350949
Original member Current member EBI ENST00000373908.5 ENSP00000363016.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373908.5Link to Ensembl Protein Viewer:ENSP00000363016.1Re-query CCDS DB by Nucleotide ID:ENST00000373908Re-query CCDS DB by Protein ID:ENSP00000363016
Original member NCBI NM_013335.3 NP_037467.2 Updated not alive Link to Nucleotide Sequence:NM_013335.3Link to Protein Sequence:NP_037467.2Re-query CCDS DB by Nucleotide ID:NM_013335Re-query CCDS DB by Protein ID:NP_037467
Current member NCBI NM_013335.4 NP_037467.2 Accepted alive Link to Nucleotide Sequence:NM_013335.4Link to Protein Sequence:NP_037467.2Re-query CCDS DB by Nucleotide ID:NM_013335Re-query CCDS DB by Protein ID:NP_037467Link to BLAST:NP_037467.2
Original member NCBI NM_205847.2 NP_995319.1 Updated not alive Link to Nucleotide Sequence:NM_205847.2Link to Protein Sequence:NP_995319.1Re-query CCDS DB by Nucleotide ID:NM_205847Re-query CCDS DB by Protein ID:NP_995319
Current member NCBI NM_205847.3 NP_995319.1 Accepted alive Link to Nucleotide Sequence:NM_205847.3Link to Protein Sequence:NP_995319.1Re-query CCDS DB by Nucleotide ID:NM_205847Re-query CCDS DB by Protein ID:NP_995319Link to BLAST:NP_995319.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_037467.2 420 Q96IJ6-1 420 100% 0 0
NP_995319.1 420 Q96IJ6-1 420 100% 0 0

Chromosomal Locations for CCDS 2441.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 219499976 219500015 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219500121 219500218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219501476 219501579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219501851 219502037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219502382 219502441 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219504083 219504213 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219505228 219505362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219505458 219505555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219505715 219505761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219505980 219506072 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219506254 219506422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 219506698 219506798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1263 nt):
ATGCTCAAAGCGGTGATCCTGATTGGAGGCCCTCAAAAGGGAACTCGCTTCAGACCTTTGTCTTTTGAGG
TG
CCCAAACCATTGTTTCCTGTGGCAGGGGTCCCTATGATCCAACACCATATTGAAGCCTGTGCCCAGGT
C
CCTGGAATGCAGGAGATTCTGCTCATTGGCTTCTACCAACCTGATGAGCCCCTCACCCAGTTCCTAGAA
GCC
GCCCAGCAGGAGTTTAACCTTCCAGTCAGGTACCTGCAGGAATTTGCCCCCCTAGGCACAGGGGGTG
GT
CTTTACCATTTTCGAGACCAGATCCTGGCTGGGAGCCCCGAGGCATTCTTCGTGCTCAATGCTGATGT
C
TGCTCCGACTTCCCCTTGAGTGCTATGTTGGAAGCCCACCGACGCCAGCGTCACCCTTTCTTACTCCTT
GGC
ACTACGGCTAACAGGACGCAATCCCTCAACTACGGCTGCATCGTTGAGAATCCACAGACACACGAGG
TA
TTGCACTATGTGGAGAAACCCAGCACATTTATCAGTGACATCATCAACTGCGGCATCTACCTCTTTTC
T
CCTGAAGCCTTGAAGCCTCTTCGGGATGTCTTCCAGCGTAATCAGCAGGATGGGCAATTGGAGGACTCA
CCA
GGCTTGTGGCCAGGGGCAGGTACCATCCGCCTAGAGCAGGATGTGTTTTCAGCCCTGGCAGGGCAGG
GC
CAGATATACGTGCATCTCACTGATGGTATCTGGAGTCAGATCAAGTCCGCAGGTTCAGCCCTCTACGC
C
TCCCGCCTCTACCTGAGCCGATACCAGGACACTCACCCAGAACGGCTGGCCAAGCACACCCCAGGGGGC
CCA
TGGATCCGAGGGAATGTGTACATCCACCCGACCGCCAAGGTGGCCCCCTCGGCTGTGCTGGGCCCCA
AC
GTCTCCATCGGGAAGGGGGTGACCGTGGGTGAGGGTGTGCGGCTCCGGGAGAGCATCGTCCTCCATGG
A
GCCACTTTGCAGGAGCACACGTGTGTTCTGCATAGCATCGTGGGCTGGGGGAGCACCGTGGGACGCTGG
GCC
CGCGTGGAGGGTACCCCCAGTGACCCTAACCCCAACGATCCCCGAGCCCGCATGGACAGTGAGAGCC
TC
TTCAAGGACGGGAAGCTGCTGCCTGCTATCACCATCCTGGGCTGCCGAGTCCGGATCCCTGCCGAGGT
G
CTCATCCTGAACTCGATTGTTCTGCCACACAAGGAGCTGAGCCGAAGCTTCACCAACCAGATCATCCTC
TGA


Translation (420 aa):
MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTQFLE
A
AQQEFNLPV
RYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLL
G
TT
ANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDS
P
GLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQIKSA
GSALYASRLYLSRYQDTHPERLAKHTPGG
P
WIR
GNVYIHPTAKVAPSAVLGPNVSIGKGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRW
A
RVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITIL
GCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser