NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24382.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24382.1 Public Mus musculus 11 Osm 21 106 86 CCDS HistoryNCBI Gene:18413Re-query CCDS DB by CCDS ID:24382.1Re-query CCDS DB by GeneID:18413See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24382.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000075221 ENSMUSP00000074708 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000075221Link to Ensembl Protein Viewer:ENSMUSP00000074708Re-query CCDS DB by Nucleotide ID:ENSMUST00000075221Re-query CCDS DB by Protein ID:ENSMUSP00000074708
Original member Current member EBI,WTSI OTTMUST00000011263 OTTMUSP00000005249 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011263Link to Vega Protein Viewer:OTTMUSP00000005249Re-query CCDS DB by Nucleotide ID:OTTMUST00000011263Re-query CCDS DB by Protein ID:OTTMUSP00000005249
Original member Current member NCBI NM_001013365.2 NP_001013383.1 Accepted alive Link to Nucleotide Sequence:NM_001013365.2Link to Protein Sequence:NP_001013383.1Re-query CCDS DB by Nucleotide ID:NM_001013365Re-query CCDS DB by Protein ID:NP_001013383Link to BLAST:NP_001013383.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001013383.1 263 P53347 263 100% 0 0

Chromosomal Locations for CCDS 24382.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 4236883 4236913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 4238406 4238542 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 4239386 4240009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (792 nt):
ATGCAGACACGGCTTCTAAGAACACTGCTCAGTTTGACCCTCAGTCTCCTCATCCTGAGCATGGCACTGG
CC
AATCGTGGCTGCTCCAACTCTTCCTCTCAGCTCCTCAGCCAGCTGCAGAATCAGGCGAACCTCACGGG
G
AACACAGAATCACTCTTGGAGCCCTATATCCGCCTCCAAAACCTGAACACACCTGACCTGAGAGCTGCC
TGC
ACCCAGCACTCTGTGGCCTTCCCCAGTGAGGACACACTCCGGCAACTGAGCAAGCCTCACTTCCTGA
GC
ACTGTGTACACCACACTGGACAGAGTCTTGTACCAACTGGATGCTTTAAGACAGAAATTTCTGAAGAC
T
CCGGCTTTTCCAAAGCTGGACAGTGCCCGGCACAATATCCTCGGCATAAGGAACAATGTTTTCTGCATG
GCC
CGGCTGCTCAACCACTCCCTGGAGATACCTGAGCCCACACAGACAGACTCTGGGGCCTCACGGTCCA
CT
ACAACACCAGATGTCTTTAATACCAAGATAGGCAGCTGTGGCTTTCTCTGGGGATACCATCGCTTCAT
G
GGCTCAGTGGGGAGGGTCTTCAGGGAATGGGACGATGGCTCCACACGCAGCCGGAGACAGAGCCCGCTC
CGG
GCCCGGCGCAAGGGAACCCGCAGAATCCGGGTCCGGCACAAGGGAACCCGCAGAATCCGGGTCCGGC
GC
AAGGGAACCCGCAGAATCTGGGTCCGGCGCAAGGGATCCCGCAAAATCAGACCTTCCAGGAGCACCCA
G
AGCCCGACGACCAGGGCCTAG


Translation (263 aa):
MQTRLLRTLLSLTLSLLILSMALANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAA
C
TQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCM
A
RLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRRQSPL
R
ARRKGTRRIRVRHKGTRRIRVRRKGTRRIWVRRKGSRKIRPSRSTQSPTTRA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser