NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24354.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24354.1 Public Mus musculus 11 Eif4enif1 23 108 98 CCDS HistoryNCBI Gene:74203Re-query CCDS DB by CCDS ID:24354.1Re-query CCDS DB by GeneID:74203See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24354.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000110049.7 ENSMUSP00000105676.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110049.7Link to Ensembl Protein Viewer:ENSMUSP00000105676.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000110049Re-query CCDS DB by Protein ID:ENSMUSP00000105676
Original member Current member EBI ENSMUST00000179770.7 ENSMUSP00000136768.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000179770.7Link to Ensembl Protein Viewer:ENSMUSP00000136768.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000179770Re-query CCDS DB by Protein ID:ENSMUSP00000136768
Original member Current member NCBI NM_001166547.1 NP_001160019.1 Accepted alive Link to Nucleotide Sequence:NM_001166547.1Link to Protein Sequence:NP_001160019.1Re-query CCDS DB by Nucleotide ID:NM_001166547Re-query CCDS DB by Protein ID:NP_001160019Link to BLAST:NP_001160019.1
Original member Current member NCBI NM_023743.2 NP_076232.2 Accepted alive Link to Nucleotide Sequence:NM_023743.2Link to Protein Sequence:NP_076232.2Re-query CCDS DB by Nucleotide ID:NM_023743Re-query CCDS DB by Protein ID:NP_076232Link to BLAST:NP_076232.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001160019.1 983 Q9EST3-1 983 100% 0 0
NP_076232.2 983 Q9EST3-1 983 100% 0 0

Chromosomal Locations for CCDS 24354.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 3203658 3203750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3213260 3213333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3215592 3215719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3220244 3220530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3221093 3221294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3224632 3224807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3227395 3227530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3227706 3227885 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3229869 3230101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3233988 3234059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3234462 3234645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3235581 3235660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3236214 3236353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3239401 3239485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3240895 3241027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3242377 3242718 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3243183 3243350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 3243851 3244089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2952 nt):
ATGGAGAAAAGTGTGGCTGAAACAGAAAATGGAGATGCTTTCCTTGAGCTGAAGAAACTGCCCACCTCCA
AA
TCCCCCCATCGCTATACGAAAGAGGAGCTCTTGGATATAAAAGAACGTCCATACTCCAAGCAGAGGCC
A
TCATGCCTCTCTGAAAAATATGACAGTGATGGTGTCTGGGACCCTGAGAAGTGGCATGCCTCTCTCTAC
CCA
GCCTCGGGGCGGAGCTCACCAGTGGAAAGTCTGAAGAAAGAGTCAGAATCCGATCGACCTTCTCTGG
TG
CGCAGAATAGCAGATCCACGAGAGCGAGTGAAAGAAGATGACTTAGATGTTGTTCTCAGCCCACAGAG
A
CGAAGCTTTGGAGGTGGCTGCCATGTGACAGCTGCTGTTAGCTCCCGACGATCTGGCAGTCCATTGGAG
AAA
GACAGTGATGGACTTCGCCTGCTTGGTGGACGAAGAATTGGCAGTGGAAGGATAATTTCTGCCCGGG
CC
TTTGAAAAGGATCACCGTCTCAGTGATAAGGACCTGCGAGACTTGAGAGACCGAGACAGAGAGAGGGA
C
TACAAGGACAAACGTTTCAGGAGGGAGTTTGGAGATAGTAAACGTGTCTTTGGTGAGCGTAGAAGAAAC
GAT
TCATACACTGAGGAAGAACCAGAATGGTTTTCAGCTGGACCCACCAGTCAGTCTGAAACCATAGAGC
TG
ACTGGCTTTGATGATAAGATTCTAGAGGAGGATCACAAAGGCAGAAAAAGAACAAGGCGACGGACTGC
C
TCTGTGAAGGAAGGCATAGTGGAGTGCAATGGAGGGGTGGCTGAAGAGGACGAGGTGGAAGTCATTCTG
GCC
CAGGAGCCCTCTGCTGATCAGGAAGTTCCAAGGGATGTCATCCTACCTGAGCAGTCCCCAGGAGAAT
TT
GACTTTAATGAATTCTTTAACCTTGATAAGGTGCCATGCTTGGCTTCGATGATAGAAGATGTTCTGGG
G
GAAGGATCGGTCTCTGCCAGCCGCTTCAGTAGGTGGTTCTCTAACCCAAGCCGGTCAGGGAGCAGATCC
AGC
AGCCTTGGATCCACACCCCATGAAGAACTTGAGAGACTGGCAGGTTTGGAGCAAGCCGTCCTCTCTC
CT
GGACAGAACTCGGGGAATTATTTTGCTCCTATACCATCGGAAGACCATGCTGAAAATAAAGTGGACAT
T
TTAGAAATGCTACAGAAAGCCAAAGTAGATTTAAAACCTCTTCTTTCTAGCCTTTCTGCAAATAAAGAA
AAA
CTTAAGGAGAGCTCACATTCAGGGGTTGTACTTTCAGTGGAAGAGGTAGAAGCAGGGCTGAAGGGCT
TG
AAAGTGGACCAGCAAATGAAGAATTCAACTCCCTTCATGGCAGAACATTTAGAGGAGACCCTGAGTGC
T
GCGAGTAGCAATAGACAGCTCAAGAAAGATGGAGATATGACTGCATTCAACAAGCTAGTGAACACCATG
AAG
GCAAGTGGAACTTTGCCTACCCAGCCCAAAGTCAGTCGAAACGTTGAAAGTCACTTATTGGCCCCTG
CT
GAGATTCCAGGCCAGCCTGTTTCTAAAAACATCCTACAGGAACTTCTGGGTCAACCGGTTCAGAGACC
C
GCTTCTTCCAATCTTCTCAGTGGCCTTATGGGGAGCTTGGAGGCTACTGCATCTTTATTGAGCCAAAGA
GCG
CCCTCTCCTCCAATGTCACAGGTATTTCGAACTCAAGCAGCCTCAGCAGACTACCTTCATCCAAGGA
TA
CCATCACCAATAGGTTTCCCTTCAGGACCCCAGCAACTACTTGGAGATCCATTCCAAGGCATGCGCAA
G
CCCATGAGTCCTGTCTCAGCCCAGATGAGCCAGCTAGAATTGCAGCAAGCTGCTTTGGAGGGGCTGGCC
CTA
CCACATGACCTTGCAGTCCAGACAGCACCCTTCTACCAGCCTGGTTTTAGCAAACCACAAGTGGACA
GA
ACCAGAGATGGGCTCAGAAACAGGCAACAGCGAATGTCAAAGTCACCAGCACCCATGCATGGTGGAAA
T
TCCTCTTCCCCAGCTCCTGCTGCCTCCATCACAAGCATGCTTTCTCCTTCCTTCACCCCTACCTCAGTG
ATC
CGGAAGATGTATGAAAGCAGAGAGAAAACCAAGGAGGAAATGGCACCTGGAATGGTGGTTCCTGGTG
AT
GGTAAAGAGGATACTCAGAAGACCAGCGAAGAGAACCTGCTGTCATCCAATCCCATACCCAATACTGA
T
CAAGACTCTTCTACGACAAATCCTAAGCTTTCAACATTACAGCGGTCTTCATGTTCCACCCCACTCTCC
CAG
ACCAGCCGTTATACCAAAGAACAAGATTATCGACCTAAAACAGCAGGAAGGAAAACACCTACCTTGG
CA
TCCCCAGTCCCAGGAACACCTTTTCTCCGCCCTACCCACCAAGTTCCCCTTGTCCCTCATGTTCCTAT
T
GTTCGACCTGCACACCAGCTTCACCCAGGATTAGTCCAAAGGTTGATAGCCCAAGGGGTACATCCACAG
CAT
CTTCCAAGTTTGCTCCAAGCTGGTGTGCTTCCTCCTGGGATAGACATGGCTCCTTTACAGGGGCTAT
CT
GGCCCACTCCTGGGTCAACCCTTGTACCCTTTGGTCTCTGCTGCTAGTCACCCTCTCCTAAACCCTCG
T
CCTGGGACCCCTCTGCATTTGGCGGTGATGCAGCAGCAGCTACAGCGCTCAGTTCTGCATCCTCCAGGC
TCT
AGTTCCCAGGCAGCAGCTATCAGCGTTCAGACTCCTCAGAATGTACCCAGCCGGTCGGGCATGCCCC
AC
ATGCACTCCCAGCTGGAGCATCGTACCAGCCAAAGGAGCAGCTCCCCTGTGGGCCTTGCCAAATGGTT
T
GGCTCAGATGTGCTACAGCAGCCTCTGCCCTCCATGCCCACCAAAGTCATCAGTGTAGATGAACTGGAA
TAT
AGACAGTGA


Translation (983 aa):
MEKSVAETENGDAFLELKKLPTSKSPHRYTKEELLDIKERPYSKQRPSCLSEKYDSDGVWDPEKWHASLY
P
ASGRSSPVESLKKESESDRPSLVRRIA
DPRERVKEDDLDVVLSPQRRSFGGGCHVTAAVSSRRSGSPLE
K
DSDGLRLLGGRRIGSGRIISARAFEKDHRLSDKDLRDLRDRDRERDYKDKRFR
REFGDSKRVFGERRRN
D
SYTEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKE
GIVECNGGVAEEDEVEVIL
A
QEPSADQEVPRDVILPEQSPGEFDFNEFFNLDKVPCLAS
MIEDVLGEGSVSASRFSRWFSNPSRSGSRS
S
SLGSTPHEELERLA
GLEQAVLSPGQNSGNYFAPIPSEDHAENKVDILEMLQKAKVDLKPLLSSLSANKE
K
LKES
SHSGVVLSVEEVEAGLKGLKVDQQMKNSTPFMAEHLEETLSAASSNRQLKKDGDMTAFNKLVNTM
K
ASGTLPTQPKVS
RNVESHLLAPAEIPGQPVSKNILQELLGQPVQRPASSNLLSGLMGSLEATASLLSQR
A
PSPPMSQVFRTQAASADYLHPRIPSPI
GFPSGPQQLLGDPFQGMRKPMSPVSAQMSQLELQQAALEGLA
L
PHDLAVQTAPFYQPGFSKPQVDRTRDGLRN
RQQRMSKSPAPMHGGNSSSPAPAASITSMLSPSFTPTSV
I
RKMYESREKTKEEMAPGMVVPGDGKEDTQKTSE
ENLLSSNPIPNTDQDSSTTNPKLSTLQRSSCSTPLS
Q
TSRYTKEQDYRPKTAGRKTPTLASPVPGTPFLRPTHQVPLVPHVPIVRPAHQLHPGLVQRLIAQGVHPQ
H
LPSLLQA
GVLPPGIDMAPLQGLSGPLLGQPLYPLVSAASHPLLNPRPGTPLHLAVMQQQLQRSVLHPPG
S
SSQAAAISVQTPQNVPSRSGMPHMHSQLEHRTSQRSSSPVGLAKWFGSDVLQQPLPSMPTKVISVDELE
Y
RQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser