NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24327.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24327.1 Public Mus musculus 10 Olfr800 21 106 86 CCDS HistoryNCBI Gene:258541Re-query CCDS DB by CCDS ID:24327.1Re-query CCDS DB by GeneID:258541See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 24327.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000104903 ENSMUSP00000100499 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000104903Link to Ensembl Protein Viewer:ENSMUSP00000100499Re-query CCDS DB by Nucleotide ID:ENSMUST00000104903Re-query CCDS DB by Protein ID:ENSMUSP00000100499
Original member Current member EBI,WTSI OTTMUST00000139775 OTTMUSP00000073311 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000139775Link to Vega Protein Viewer:OTTMUSP00000073311Re-query CCDS DB by Nucleotide ID:OTTMUST00000139775Re-query CCDS DB by Protein ID:OTTMUSP00000073311
Original member Current member NCBI NM_146548.1 NP_666759.1 Accepted alive Link to Nucleotide Sequence:NM_146548.1Link to Protein Sequence:NP_666759.1Re-query CCDS DB by Nucleotide ID:NM_146548Re-query CCDS DB by Protein ID:NP_666759Link to BLAST:NP_666759.1

Chromosomal Locations for CCDS 24327.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 129659808 129660743 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (936 nt):
ATGAGAAACCACACCATAACAACATTCATCCTACTGGGACTGACGGATGACCCACAACTGAAAACTCTGA
TC
TTCATCTTTCTGTTTCTCAGCTACGTGCTGAGTATGACTGGGAACCTCACGATCATATCCCTTACCTT
T
ATAGATCCACACCTAAAGACTGCTATGTACTTTTTCCTACAAAATTTCTCCTTCCTAGAAATCTCATTT
ACA
ACTGCTTGCATTCCCAGATACTTATACAACATCTCAACAGGTGACAAGACAATTACATATAACAACT
GT
GCCATTCAAATATTTTGTGTTGATCTTTTTGGTGTGACAGAATTTTTTCTGCTGGCCATCATGTCCTA
T
GACCGATATGTAGCCATCTGCAAACCCCTGCATTATAGCACCATCATGAGCAGCAGGATCTGTACAAGA
CTT
ATCCTCTGTTGCTGGGCAGCTGGCTTGTTTGTAATCCTGCCACCACTTAGCCTGGGCCTCAAGCTGG
AA
TTCTGTGACTCTAATGTTATTGACCATTTTGTCTGTGATGCAAACCCCCTCCTAAAGATCTCATGTAC
A
GAAACATGGCTCATAGAGCAGATAGTGATAGTTTGTGCAGTGTTTACATTTATCATGACCCTTGTGTGT
GTA
AGCCTTTCCTATATATACATAATCAGGACCATTCTAAGATTTCCTTCTGCACAGCAGAGGAAAAAGG
CC
TTTTCTACCTGCTCTTCCCACATGATTGTGGTTTCCATCACCTATGGCAGCTGCATCTTCATCTACAT
C
AAACCATCAGCAAAGGACTCAGTGACTATCAACAAGGGTGTGACGATTCTCACCACTTCCATTGCTCCT
ATG
TTGAACCCATTCATTTATACATTGAGGAACAAACAAGTCAAGCAGGCCTTCAATGACTCAGTTAAAA
GA
ATTGTGCTGTTCTTCCAGAAGTAG


Translation (311 aa):
MRNHTITTFILLGLTDDPQLKTLIFIFLFLSYVLSMTGNLTIISLTFIDPHLKTAMYFFLQNFSFLEISF
T
TACIPRYLYNISTGDKTITYNNCAIQIFCVDLFGVTEFFLLAIMSYDRYVAICKPLHYSTIMSSRICTR
L
ILCCWAAGLFVILPPLSLGLKLEFCDSNVIDHFVCDANPLLKISCTETWLIEQIVIVCAVFTFIMTLVC
V
SLSYIYIIRTILRFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKDSVTINKGVTILTTSIAP
M
LNPFIYTLRNKQVKQAFNDSVKRIVLFFQK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser