NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS2423.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2423.1 Public Homo sapiens 2 CYP27A1 22 109 92 CCDS HistoryNCBI Gene:1593Re-query CCDS DB by CCDS ID:2423.1Re-query CCDS DB by GeneID:1593See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2423.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000258415.8 ENSP00000258415.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000258415.8Link to Ensembl Protein Viewer:ENSP00000258415.4Re-query CCDS DB by Nucleotide ID:ENST00000258415Re-query CCDS DB by Protein ID:ENSP00000258415
Original member NCBI NM_000784.3 NP_000775.1 Updated not alive Link to Nucleotide Sequence:NM_000784.3Link to Protein Sequence:NP_000775.1Re-query CCDS DB by Nucleotide ID:NM_000784Re-query CCDS DB by Protein ID:NP_000775
Current member NCBI NM_000784.4 NP_000775.1 Accepted alive Link to Nucleotide Sequence:NM_000784.4Link to Protein Sequence:NP_000775.1Re-query CCDS DB by Nucleotide ID:NM_000784Re-query CCDS DB by Protein ID:NP_000775Link to BLAST:NP_000775.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000775.1 531 Q02318 531 100% 0 0

Chromosomal Locations for CCDS 2423.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 218782183 218782437 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 218809577 218809767 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 218812222 218812421 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 218812552 218812749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 218812924 218813096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 218814021 218814187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 218814380 218814458 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 218814545 218814757 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 218814911 218815030 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1596 nt):
ATGGCTGCGCTGGGCTGCGCGAGGCTGAGGTGGGCGCTGCGAGGGGCCGGCCGTGGCCTCTGCCCCCACG
GG
GCCAGAGCCAAGGCCGCGATCCCTGCCGCCCTCCCCTCGGACAAGGCCACCGGAGCTCCCGGAGCCGG
G
CCTGGTGTCCGGCGGCGGCAACGGAGCTTAGAGGAGATTCCACGTCTAGGACAGCTGCGCTTCTTCTTT
CAG
CTGTTCGTTCAAGGCTATGCCCTGCAACTGCACCAGTTACAGGTGCTTTACAAGGCCAAGTACGGTC
CA
ATGTGGATGTCCTACTTAGGGCCTCAGATGCACGTGAACCTGGCCAGTGCCCCGCTCTTGGAGCAAGT
G
ATGCGGCAAGAGGGCAAGTACCCAGTACGGAACGACATGGAGCTATGGAAGGAGCACCGGGACCAGCAC
GAC
CTGACCTATGGGCCGTTCACCACGGAAGGACACCACTGGTACCAGCTGCGCCAGGCTCTGAACCAGC
GG
TTGCTGAAGCCAGCGGAAGCAGCGCTCTATACGGATGCTTTCAATGAGGTGATTGATGACTTTATGAC
T
CGACTGGACCAGCTGCGGGCAGAGAGTGCTTCGGGGAACCAGGTGTCGGACATGGCTCAACTCTTCTAC
TAC
TTTGCCTTGGAAGCTATTTGCTACATCCTGTTCGAGAAACGCATTGGCTGCCTGCAGCGATCCATCC
CC
GAGGACACCGTGACCTTCGTCAGATCCATCGGGTTAATGTTCCAGAACTCACTCTATGCCACCTTCCT
C
CCCAAGTGGACTCGCCCCGTGCTGCCTTTCTGGAAGCGATACCTGGATGGTTGGAATGCCATCTTTTCC
TTT
GGGAAGAAGCTGATTGATGAGAAGCTCGAAGATATGGAGGCCCAACTGCAGGCAGCAGGGCCAGATG
GC
ATCCAGGTGTCTGGCTACCTGCACTTCTTACTGGCCAGTGGACAGCTCAGTCCTCGGGAGGCCATGGG
C
AGCCTGCCTGAGCTGCTCATGGCTGGAGTGGACACGACATCCAACACGCTGACATGGGCCCTGTACCAC
CTC
TCAAAGGACCCTGAGATCCAGGAGGCCTTGCACGAGGAAGTGGTGGGTGTGGTGCCAGCCGGGCAAG
TG
CCCCAGCACAAGGACTTTGCCCACATGCCGTTGCTCAAAGCTGTGCTTAAGGAGACTCTGCGTCTCTA
C
CCTGTGGTCCCCACAAACTCCCGGATCATAGAAAAGGAAATTGAAGTTGATGGCTTCCTCTTCCCCAAG
AAC
ACCCAGTTTGTGTTCTGCCACTATGTGGTGTCCCGGGACCCCACTGCCTTCTCTGAGCCTGAAAGCT
TC
CAGCCCCACCGCTGGCTGAGAAACAGCCAGCCTGCTACCCCCAGGATCCAGCACCCATTTGGCTCTGT
G
CCCTTTGGCTATGGGGTCCGGGCCTGCCTGGGCCGCAGGATTGCAGAGCTGGAGATGCAGCTACTCCTC
GCA
AGGCTGATCCAGAAGTACAAGGTGGTCCTGGCCCCGGAGACGGGGGAGTTGAAGAGTGTGGCCCGCA
TT
GTCCTGGTTCCCAATAAGAAAGTGGGCCTGCAGTTCCTGCAGAGACAGTGCTGA


Translation (531 aa):
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFF
Q
LFVQGYALQLHQLQ
VLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQH
D
LTYGPFT
TEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFY
Y
FALE
AICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFS
F
GKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYH
L
SKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETL
RLYPVVPTNSRIIEKEIEVDGFLFPK
N
TQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLL
A
R
LIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser