NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS24095.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24095.1 Public Mus musculus 10 Fbxo7 23 108 98 CCDS HistoryNCBI Gene:69754Re-query CCDS DB by CCDS ID:24095.1Re-query CCDS DB by GeneID:69754See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24095.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000130320.7 ENSMUSP00000120840.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000130320.7Link to Ensembl Protein Viewer:ENSMUSP00000120840.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000130320Re-query CCDS DB by Protein ID:ENSMUSP00000120840
Original member Current member NCBI NM_153195.2 NP_694875.2 Accepted alive Link to Nucleotide Sequence:NM_153195.2Link to Protein Sequence:NP_694875.2Re-query CCDS DB by Nucleotide ID:NM_153195Re-query CCDS DB by Protein ID:NP_694875Link to BLAST:NP_694875.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_694875.2 523 Q3U7U3 523 100% 0 0

Chromosomal Locations for CCDS 24095.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 86022023 86022144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 86024416 86024710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 86029009 86029236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 86030928 86031069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 86033234 86033320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 86042922 86043017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 86044423 86044599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 86046773 86046810 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 86047722 86048108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1572 nt):
ATGAAGCTGCGCGTGCGGCTTCAGAAGCGGACCCAGCCGCTCGAGGTGCCGGAGTCGGAGCCAACGCTCG
GG
CAGCTGCGCGCGCACCTCAGCCAGGTCCTGCTGCCCACGTTGGGGTTCAGTTCTGATACCCGATTTGC
A
ATTACATTGAACAACAAGGATGCCCTCACTGGAGATGAAGAGACCTTGGCTTCATATGGGATTGTTTCT
GGG
GACTTGATATGTTTGGTTCTTGAAGATGACATGCCGGCACCTAACTTACCTTCATCTACAGATACAG
AG
CATTCCTCACTCCAGGATAATGACCAACCTTCTTTGGCTGCCACCCCAAGTCAGACTAACATCCCAGA
T
GAACAAGGGACTGATTCATCCCAAGGACAGGCCACCCCATTTGATGCCTGGACTGATGACAGTATGGAA
GGG
CCTAGTCAAAATGTTGAAGCTGAGTCAATTCAGGATGCCATGAGTATGGAAGAGGTTTCTGGTTTCC
AT
CCATTGGAACCAATGCTCTGTAATGAAACAGAGGATGGGCAGGTACCACATTCTCTAGAGACCCTGTA
C
CAGTCAGCTGGCTGCTCCAACATCAGTGATGCCTTGATAGTGCTGGTGCATCTCCTGATGCTCGAGTCA
GGC
TACATTCCTCAGGGAACTGAAACCAAAGCAGTGACAATGCCTGAGAAGTGGAAGTCAAGTGGTGTAT
AC
AAACTGCAGTACACACATCCTCTCTGCGAGGGCGGCTTTGCCGTGCTTACCTGTGTGCCTTTGGGAAA
C
TTAATCATTATAAATGCTACAATAAAAGTCAACGGTGGGATTAAAAACGTGAAGTCAGTGCAGCTGCAG
CCA
GGATCCTACGTTGCTGCTGGAGTAGAACCAGGGGAAAGCGCAGCCAAAGTGTACAAAGATCTTAAGA
AG
CTCTCTCGTCTCTTCAAAGACCAGCTGGTGTACCCTCTTCTGGCTTTCACACGGCAAGTACTGAACCT
T
CCAGATGTGTTTGGGCTGGTTGTCCTTCCACTGGAGCTGAAACTACGCATCTTCCGACTTTTGGATGTT
CAT
TCTGTCCTGGCCCTGTCTGCAGTCTGTCATGACCTCCTCATTGCGTCAAATGACCCACTGCTGTGGA
GG
TGTTTGTATCTGCGGGATTTTCGAGATGGCACTGTCAGAGGTCCTGACACAGACTGGAAAGAATTGTA
T
AGAAAGAAGCACATACAAAGAAAAGAGGCTCAGAGGATGCGGCATGCAATGTTCCTACCATCAGCCCAC
CCT
ATCCCATTTTGTCCCATTCCCGTCTACCCCAGGGCCTACCTTCCCACCTCGCTGCTTCCTCCAGGAA
TC
ATTGGTGGTGAATATGATGAGAGGCCGATACTGCCTAGTGTTGGGGACCCAGTCACCTCACTTATCCC
A
AGGCCCGGGGAGCTTCCTGGTCAGTTCCGTCCACTCAGACCACGTTTTGACCCTGTTGACCCACTTCCA
GGA
CCTCACTCCCTCTTGCCAGGAAGAGCTATCCCCAACAACAGATTTCCCTTCAGACCCGGCAGGGGTA
GG
TCAGCTGACAGCCGGCTGCCATTCCTGTGA


Translation (523 aa):
MKLRVRLQKRTQPLEVPESEPTLGQLRAHLSQVLLPTLGFSSDTRFAITLNNKDALTGDEETLASYGIVS
G
DLICLVLEDDMPAPNLPSSTDTEHSSLQDNDQPSLAATPSQTNIPDEQGTDSSQGQATPFDAWTDDSM
E
G
PSQNVEAESIQDAMSMEEVSGFHPLEPMLCNETEDGQVPHSLETLYQSAGCSNISDALIVLVHLLMLES
G
YIPQ
GTETKAVTMPEKWKSSGVYKLQYTHPLCEGGFAVLTCVPLGNLIIINATIKVNGGIKNVKSVQLQ
P
GSYVAAGVEP
GESAAKVYKDLKKLSRLFKDQLVYPLLAFTRQVLNLPDVFGLVVLPLELKLRIFRLLDV
H
SVLALSAVCHDLLIASNDPLLWRCLYLRDFR
DGTVRGPDTDWKELYRKKHIQRKEAQRMRHAMFLPSAH
P
IPFCPIPVYPRAYLPTSLLPPGIIGGEYDERPILPSVGDPVTSLIPRPGELPGQFRPLRPRFDPVDPLP
G
PHSLLPGRAIPNNRFPFRPGRGRSADSRLPFL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser