NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24010.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24010.1 Public Mus musculus 10 Atp5d 23 108 98 CCDS HistoryNCBI Gene:66043Re-query CCDS DB by CCDS ID:24010.1Re-query CCDS DB by GeneID:66043See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24010.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000003156.14 ENSMUSP00000003156.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000003156.14Link to Ensembl Protein Viewer:ENSMUSP00000003156.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000003156Re-query CCDS DB by Protein ID:ENSMUSP00000003156
Original member Current member EBI ENSMUST00000105367.7 ENSMUSP00000101006.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105367.7Link to Ensembl Protein Viewer:ENSMUSP00000101006.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000105367Re-query CCDS DB by Protein ID:ENSMUSP00000101006
Original member Current member NCBI NM_025313.2 NP_079589.2 Accepted alive Link to Nucleotide Sequence:NM_025313.2Link to Protein Sequence:NP_079589.2Re-query CCDS DB by Nucleotide ID:NM_025313Re-query CCDS DB by Protein ID:NP_079589Link to BLAST:NP_079589.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079589.2 168 Q9D3D9 168 100% 0 0

Chromosomal Locations for CCDS 24010.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 80142466 80142606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80143832 80143985 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80145219 80145307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80145423 80145545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (507 nt):
ATGTTGCCCGCCTCACTGCTTCGTCACCCGGGCCTGCGCCGCCTGATGCTTCAGGCGCGTACATACGCCG
AG
GCCGCCGCTGCACCTGCCCCCGCCGCCGGGCCCGGACAGATGTCCTTCACCTTTGCCTCCCCGACGCA
G
GTGTTCTTTGACAGTGCCAACGTCAAGCAAGTGGACGTGCCTACGCTGACTGGAGCCTTTGGCATCTTG
GCA
TCCCATGTCCCCACACTACAGGTCCTACGGCCTGGGCTGGTAGTGGTTCACACAGAAGACGGCACCA
CG
ACTAAGTACTTTGTGAGCAGCGGCTCCGTCACTGTGAATGCCGACTCCTCTGTGCAGTTACTAGCTGA
A
GAAGCTGTGACACTGGACATGCTGGACCTGGGGGCAGCCCGGGCCAACCTGGAGAAGGCGCAGTCAGAA
CTG
TCAGGTGCGGCGGACGAGGCAGCACGGGCTGAGATCCAGATCCGTATTGAGGCCAATGAAGCCCTAG
TG
AAGGCCCTGGAGTAG


Translation (168 aa):
MLPASLLRHPGLRRLMLQARTYAEAAAAPAPAAGPGQMSFTFASPTQVFFDSANVKQVDVPTLTGAFGIL
A
SHVPTLQVLRPGLVVVHTEDGTTTKYF
VSSGSVTVNADSSVQLLAEEAVTLDMLDLGAARANLEKAQSE
L
SGAADEAARAEIQIRIEANEALVKALE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser