NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS23838.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23838.1 Public Mus musculus 10 Ros1 21 106 86 CCDS HistoryNCBI Gene:19886Re-query CCDS DB by CCDS ID:23838.1Re-query CCDS DB by GeneID:19886See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23838.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020045 ENSMUSP00000020045 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020045Link to Ensembl Protein Viewer:ENSMUSP00000020045Re-query CCDS DB by Nucleotide ID:ENSMUST00000020045Re-query CCDS DB by Protein ID:ENSMUSP00000020045
Original member Current member EBI,WTSI OTTMUST00000065421 OTTMUSP00000032607 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065421Link to Vega Protein Viewer:OTTMUSP00000032607Re-query CCDS DB by Nucleotide ID:OTTMUST00000065421Re-query CCDS DB by Protein ID:OTTMUSP00000032607
Original member Current member NCBI NM_011282.2 NP_035412.2 Accepted alive Link to Nucleotide Sequence:NM_011282.2Link to Protein Sequence:NP_035412.2Re-query CCDS DB by Nucleotide ID:NM_011282Re-query CCDS DB by Protein ID:NP_035412Link to BLAST:NP_035412.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035412.2 2340 Q78DX7 2340 100% 0 0

Chromosomal Locations for CCDS 23838.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 52046016 52046326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52050874 52051037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52064674 52064808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52066213 52066413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52067005 52067102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52072054 52072183 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52073068 52073132 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52075813 52075975 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52077849 52077984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52081959 52082042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52085164 52085354 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52087881 52087998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52090946 52091114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52096022 52096198 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52098670 52098902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52099997 52100141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52101709 52101908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52115886 52116062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52118120 52118403 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52120796 52121001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52123217 52123419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52124058 52124121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52125719 52125981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52128417 52128561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52128939 52129099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52129563 52129777 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52130886 52130986 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52142140 52142331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52143247 52143425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52144765 52144875 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52145748 52145960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52154782 52155278 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52161809 52161906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52162706 52162890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52163885 52164007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52165340 52165416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52166046 52166247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52168603 52168741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52169965 52170113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52172841 52172901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52178947 52178973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52180162 52180221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52181779 52181823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52194831 52194956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7023 nt):
ATGAAGAACATCTGCTGGCTCACCCTGAAACTTGTGAAGTTTGTGGTCCTTGGGTGCATCATATGGATTT
CT
GTGGCACAGAGTACAGTTCTGAGCAGCTGCCTAACGTCCTGTGTAACTAACCTGGGCAGGCAGCTTGA
C
AGTGGCACACGGTACAATCTGAGTGAGGCGTGCATCCATGGATGTCAGTTTTGGAACTCTGTAGATCAG
GAA
ACGTGTGCTTTAAAGTGTAATGACACCTACGCCACCATTTGTGAGAGGGAGTCCTGTGAGGTCGGCT
GC
AGCAATGCGGAGGGTAGCTACGAAGAGGAAGTGCTGGAAAGCACAGAACTTCCTACAGCACCCTTTGC
A
TCTTCCATTGGAAGTCATGGTGTGACATTACGCTGGAACCCTGCCAACATCTCTGGAGTCAAATACATA
ATT
CAATGGAAATATGCCCAACTTCCAGGAAGCTGGACTTTCACGGAGACCGTGTCCAAGCTCTCATACA
CG
GTGGAACCCCTGCATCCATTCACAGAATATATTTTTCGAGTGGTTTGGATCTTCACAGCCCAACTGCA
T
CTTTATTCCCCACCAAGTCCCAGTTACAGGACTCATCCTTATGGAGTTCCAGAAACTGCACCTCTCATC
CTG
AACATGGAAAGCTGGAGCCCTGATACTGTGGAGGTCAGCTGGGCTCCACCTCATTTCCCAGGTGGAC
CT
ATTTTGGGTTATAATTTAAGGCTCATCAGTAAAAATCAAAAATTAGATTCAGGGACACAGAGAACCAG
T
TTCCAGTTTTATTCTACTCTACCAAACACCACCTACAGGTTTTCTATCGCAGCAGTCAATGAAGTTGGT
GAG
GGGCCAGAAGCAGAATCTACAGTTACCACTCCATCCCCATCAGTTCAAGAAGAAGAACAATGGCTCT
TT
TTATCCAGAAAAACTTCTCTAAGAAAGAGGTCTTTGAAGTACTTAGTAGATGAAGCACATTGCCTTTG
G
TCAGATGCTATACACCATAATATTACAGGAATATCAGTCTATGCTCAGCAGCAAGTGGTTTATTTTTCA
GAA
GGAACTGTCATCTGGATGAAGGGGGCTGCCAACATGTCTGATGTGTCTGACCTGAGAATTTTTTACC
AA
GGCTCAGGTCTAGTGTCTTCTATCTCCATAGACTGGCTGTACCAAAGGATGTATTTCATCATGGATAA
A
CTGGTATATGTCTGTGAATTAAAGAATTGCTCAAATTTAGAGGAAATCACTCCCTTCTCTCTTATTGCA
CCT
CAGAAAGTTGTGGTTGACTCCTACAATGGGTACCTCTTTTATCTCCTGAGAGACGGCATCTACAGAG
TC
AATCTCCCTTTGCCATCTGGCAGGGACACCAAAGCTGTGCGTATTGTGGAGAGTGGCACATTAAAGGA
C
TTTGCAGTAAAGCCCCAATCCAAGCGAATCATTTACTTCAATGACACCATGCAACTCTTCATGTCAACG
TTT
CTGGATGGCTCTGCCTTCCACCGGGTCCTGCCTTGGGTCCCCCTTGTGACTGTGAAGAGCTTTGCTT
GT
GAAAACAATGACTTCCTCATCACAGATGGCAAGGCCATTTTTCAGCAGGACTCCCTGTCTTTCAATGA
A
TTCATCGTGGGATGTGACCTGAGTCACATAGAAGAGTTTGGGTTTGGTAACTTGGTCATCTTTGGCTCC
TCT
GTCCAGTCATACCCTCTGCCAGGACATCCACAGGAGGTCTCAGTGCTGTTTGGTTCTCGAGAGGCCC
TT
ATTCAGTGGACGCCTCCTGCTCTCGCCATAGGAGCCAGTCCTTCCGCCTGGCAGAACTGGACTTATGA
A
GTCAAAGTTTATTCCCAGGACATCCTTGAAATCACTCAAGTTTTCTCGAACATAAGCGGGACCATGCTT
AAT
GTACCCGAACTGCAGAGTTCTACAAAGTACACTGTCTCTGTGAGAGCAAGTTCTCCTAAAGGCCCAG
GC
CCCTGGTCAGCACCATCAGTGGGTACCACCTTGGTACCAGCTACTGAACCACCATTCATCATGGCTGT
G
AAAGAAGATGGGCTCTGGAGCAAACCACTCTGTAGTTTTGGTCCAGGAGAATTCCTGTCCTCTGATGTA
GGA
AACGTGTCAGATATGGATTGGTACAACAACAGCCTCTACTACAGTGACACAAAAGGCAACGTTTATG
TG
CGGCCTCTGAATGGGATGGATATCTCAGAGAATTATCACATACCCAGCATTGTAGGAGCTGGGGCTTT
G
GCCTTTGAATGGCTGGGTCACTTTCTCTACTGGGCTGGGAAGACATATGTGATCCAAAGGCAGTCTGTG
TTG
ACGGGACACACGGACATTGTGACTCATGTGAAGCTGTTGGTGAATGACATGGCTGTGGATTCAGTTG
GT
GGCTATCTCTATTGGACAACACTCTACTCAGTTGAAAGCACCAGACTCAATGGAGAAAGTTCTCTTGT
A
CTACAGGCTCAGCCCTGGCTCTCTGGAAAAAAGGTTATTGCTCTAACACTAGACCTCAGTGATGGGCTC
CTG
TATTGGCTGGTGCAGGACAATCAGTGTATTCATCTGTACACAGCTGTTCTTCGAGGATGGAGTGGTG
GG
GATGCTACCATCACAGAGTTTGCAGCCTGGAGTACTTCTGAAATCTCCCAGAATGCACTGATGTACTA
C
AGTGGTAGACTCTTCTGGATCAATGGATTTAGGATCATTACAGCACAGGAAATAGGTCAGAGAACCAGT
GTG
TCTGTTTCGGAGCCAGCGAAATTCAATCAGTTCACAATTATACAGACATCTCTCAAGCCTCTGCCAG
GA
AACTTTTCCTCTACTCCCAAGGTTATCCCAGATCCTGTTCAGGAGTCTTCATTTCGAATTGAAGGACA
C
ACTTCAAGTTTCCAAATCCTGTGGAATGAGCCCCCTGCGGTGGACTGGGGCATCGTTTTCTACAGTGTG
GAA
TTTAGCACTCATTCCAAGTTCCTGATTATTGAACAACAGTCTTTACCTATTTTTACTGTGGAAGGAC
TG
GAGCCCTATACCTTATTTAATCTTTCTGTCACTCCTTATACCTACTGGGGAAAGGGCCAAAAAACATC
T
CTATCATTTCGTGCACCTGAATCAGTTCCATCAGCACCAGAAAACCCCAGAATATTTATATTGTCAAGC
GGA
AGATACACCAAGAAGAATGAAGTTGTGGTAGAGTTCAGGTGGAATAAACCTAAGCATGAAAATGGAG
TG
CTAACCAAATTTGAAATCTTCTATCACATATCTAAACAAAGTGGCACAAATAGATCAACTGAAGACTG
G
ATGTCTGCCAGTGTTATACCCCCAGTGATGTCTTTTCAACTTGAGGCTGTGAGTCCTGAGTATACTGTT
GCC
TTCCAGGTTAGAGTCTTCACATCCAAAGGGCCAGGGCCATTTTCTGATATAGTGATGTCTAAAACAT
CA
GAAATCAAGCCATGTCCGTATCTCATATCTCTTCTCGGCAATAAGATCGTGTTTCTAGACATGGATCA
A
AATCAAGTTTTGTGGACATTTTCCCTGGAGGGAGACGTCAGCACAGTGGGGTACACAACAGACGATGAA
ATG
GGGTATTTCGCTCAAGGAGACACGCTCTTCCTTCTGAATTTGCGTAATCATTCCAGTTCCAAGCTTT
TC
CAGGATGCACTGGTTTCTGACATTAGAGTTATTGCTGTTGATTGGATTGCAAGGCACCTCTACTTTGC
T
CTGAAAGCATCACAAAACGGAACACAGATATTCAATGTTGACCTTGAACACAAGGTGAAATCCCCCAGG
GAG
GTGAAGACTTGCAAAGCACATACAACAATAATTTCTTTCTCTATATATCCCCTCTTGAGTCGCTTGT
AT
TGGACAGAAGTTTCAGATCTGGGCCATCAGATGTTCTACTGCAATATTAGCAATCACACCTCGCAACA
T
GTTCTACAACCCAAGGCTTCAAACCAACATGGAAGGAGTCAATGTTCTTGTAATGTGACAGAATCTGAG
TTA
AGTGGGGCAATGACTGTGGATACCTCTGACCCAGACAGACCATGGATATACTTTACCAAAAGGCAAG
AG
ATCTGGGCCATGGATCTGGAAGGATGTCAGTGTTGGAAAGTCATCATGGTACCTACTATCCCTGGAAA
A
AGAATCATTAGCTTAACAGTGGATGGGGAGTTTATATATTGGATCATGAAAACAAAGGATGATGCCCAA
ATT
TATCAAGCAAAGAAGGGAAGCGGGGCCATCCTTTCCCAAGTGAAGGCCTCCAGGAGTAAGCATATCT
TG
GCTTACAGTTCTGCTCTGCAGCCTTTTCCAGATAAAGCATATCTGTCTCTAGCTTCAGATATGGTAGA
A
GCAACTATATTATATGCCACCAACACCAGCCTCACACTCAAATTACCTCCAGTCAAGACAAACCTCACG
TGG
CATGGTATTACCCACCCCACGTCAACATACCTGATTTACTATATGGAAGCTAATAGGGCAAACAGCT
CT
GACAGGAGACACAAAATGCTGGAATCACAGGAGAATGTAGCCCGGATTGAAGGTCTGCAGCCATTTTC
A
ATGTACATGATTCAGATAGCTGTGAAGAACTATTATTCAGAGCCTTTAGAACATTTACCTCTTGGAAAA
GAG
ATTCAAGGACAAACTAAAAGTGGAGTGCCTGGGGCAGTTTGTCATATCAACGCAACTGTGTTGTCGG
AC
ACCAGTCTCCATGTATTCTGGACAGAATCCCATAAGCCAAACGGACCAAAAGAGTCAGTCCGCTATCA
G
CTGGTTATGTCATACCTGGCTCCCATTCCTGAGACTCCTCTAAGACAGGGTGAATTTCCAAGTGCCAAG
CTT
TCTCTGCTCATCACTAAACTATCTGGTGGACAGCTCTATGTGATGAAGGTTCTGGCGTGCCACCCTG
AG
GAAATGTGGTGTACTGAGAGTCATCCTGTCAGTGTCAACATGTTTGACACACCAGAGAAACCCTCTGC
C
TTGGTTCCAGAGAACACTAGTCTGCAGTTAGATTGGAAGGCTCGATCAAACGTTAACCTCACCGGATTT
TGG
TTTGAACTCCAGAAGTGGAAATATAATGAGTTTTACCATGTCAAAGCTTCATGCAGCCAAGGTCCAG
TT
TATGTCTGTAACATCACAGATCTACAACCTTACACCTCCTATAACATTCGAGTGGTGGTGGTCTATAC
G
ACAGGAGAAAATAGCTCCTCCATTCCAGAGAGTTTCAAGACAAAAGCCGGAGTCCCAAGCAAACCAGGT
ATT
CCTAAATTACTAGAAGGGAGTAAAAATTCCATCCAGTGGGAAAAAGCTGAAGATAATGGGAGCAGAT
TG
ATGTACTACACCCTTGAGGTCAGAAAAGGCATTTCAAATGACTCACAGAACCAGAGTTCAAGGTGGAA
G
GTGGTGTTTAATGGGTCCTGCAGTAGCATTTGCACATGGAGATCAAAAAACCTAAAAGGAACATTTCAG
TTC
AGAGCAGTTGCTGCAAATGAAATTGGACTTGGAGAATATAGTGAAATCAGTGAAGACATTACATTAG
TG
GAAGATGGTGTTTGGATAACAGAAACAAGTTTTATACTTACTATCATAGTTGGGATATTTCTGGTTGC
T
ACAGTCCCACTGACCTTTGTCTGGCATAGAAGCTTGAAAAGTCACAAAGCTTCCAAGGAAGGCCTCTCG
GTT
CTCAACGACAACGACAAAGAGTTGGCTGAGCTTCGAGGTCTGGCGGCTGGAGTGGGACTGGCCAATG
CC
TGCTACGCAGTACATACTGTTCCAACCCAAGAAGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAGAA
G
CTGAGCCTGCGTCTTTTGTTGGGAAGTGGAGCTTTTGGAGAAGTGTATGAAGGCACAGCTATAGACATC
CTA
GGCGTGGGAAGTGGAGAAATCAAAGTGGCAGTGAAGACCTTGAAGAAAGGTTCAACAGACCAGGAGA
AG
ATTGAGTTCCTGAAGGAGGCGCACCTGATGAGCAAGTTTAATCACCCCAACATTCTGAAGCAGCTGGG
A
GTCTGTCTGTTAGGCGAACCCCAGTACATTATTCTGGAACTGATGGAAGGGGGAGACCTTCTAAGCTAT
CTG
CGCAAAGCTCGGGGGACAACGTTTCATGGTCCTTCACTCACCTTGCTTGACCTTGTAGAGCTGTGTG
TA
GATATTTCAAAAGGCTGCGTCTACTTGGAGCAGATGCACTTCATTCACAGGGATCTGGCAGCTCGGAA
T
TGCCTTGTATCAGTGAAAGACTACACCAGTCCTCGGGTAGTCAAGATTGGTGACTTTGGATTGGCAAGA
GAA
ATCTATAAAAATGATTATTATAGAAAGAGAGGGGAAGGCCTGCTTCCTGTTCGGTGGATGGCTCCTG
AA
AACTTGATGGACGGAATCTTCACTTCTCAGTCTGATGTATGGTCCTTTGGAATTTTGGTGTGGGAGAT
T
TTAACTCTCGGTCATCAACCTTATCCAGCGCATTCCAACCTTGATGTTTTAAACTATGTGCAAGCAGGA
GGG
AGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGTCCCAATGCTGGGCTCAAG
AA
CCTGACCAAAGACCCACTTTCCATAACATTCAAAACCAGCTTCAGTTATTCAGAAATGTTTTCTTAAA
C
AATGTTTCTCATTGTGGAGAAGCAGCTCCCACCGGTGGAGTCATCAACAAAGGCTTTGAAGGTGAAGAT
GAT
GAAATGGTCACTTTGAACTCAGATGACACGATGCCAGTTGCCTTGATGGAAACCAAGAACCAAGAAG
GA
TTAAATTATATGGTGCTTGCCACAAAATGTAGCCAAGGTGAAGGAAGTTATGAGGGTCCTCTAGGCCC
T
AAGGAACTTGGGTCATGTGATCTGAAGAAAGACAAGAAGCAACCACAGGCAGACAAAGATTTCTGCCAG
GAA
CCACAGGTGGCTTATGGCTCTCCTGGCCTGTCTGAAGGCCTGAATTATGCCTGTCTTGCTCACAGTG
AA
CATGGAGATGTGTCTGAATAA


Translation (2340 aa):
MKNICWLTLKLVKFVVLGCIIWISVAQSTVLSSCLTSCVTNLGRQLDSGTRYNLSEACIHGCQFWNSVDQ
E
TCALKC
NDTYATICERESCEVGCSNAEGSYEEEVLESTELPTAPFASSIGSHGVTLRWNPANISGVKYI
I
QWKYAQLPGSWTFTE
TVSKLSYTVEPLHPFTEYIFRVVWIFTAQLHLYSPPSPSYRTHPYGVPETAPLI
L
NMESWSPDTVEVSWAPPHFPGGPILGYNLRLISKNQKLDSGTQRTSFQFYSTLPNTTY
RFSIAAVNEVG
E
GPEAESTVTTPSPS
VQEEEQWLFLSRKTSLRKRSLKYLVDEAHCLWSDAIHHNITGISVYAQQQVVYFS
E
GTVIWMKGAANMSDVSDLRIFYQGSGLVSSISIDWLYQRMYFIMDKL
VYVCELKNCSNLEEITPFSLIA
P
QKVVVDSYN
GYLFYLLRDGIYRVNLPLPSGRDTKAVRIVESGTLKDFAVKPQSKRIIYFNDTMQLFMST
F
LDGSAFHRVLPWVPLVTVKSFACENNDFLITDGKAIFQQDSLSFNEFIVGCDLSHIEEFGFGNLVIFGS
S
VQSYPLPGHPQEVSVLFGSREALIQWTPPALAIGA
SPSAWQNWTYEVKVYSQDILEITQVFSNISGTML
N
VPELQSSTKYTVSVRASSPKGPGPWSAPSVGTTLVP
ATEPPFIMAVKEDGLWSKPLCSFGPGEFLSSDV
G
NVS
DMDWYNNSLYYSDTKGNVYVRPLNGMDISENYHIPSIVGAGALAFEWLGHFLYWAGKTYVIQRQSV
L
TGHTDIVTHVKLLVNDMAVDSVGGYLYWTTLYSVESTRLNGESSLVLQAQPWLSGKK
VIALTLDLSDGL
L
YWLVQDNQCIHLYTAVLRGW
SGGDATITEFAAWSTSEISQNALMYYSGRLFWINGFRIITAQEIGQRTS
V
SVSEPAKFNQFTIIQTSLKPLP
GNFSSTPKVIPDPVQESSFRIEGHTSSFQILWNEPPAVDWGIVFYSV
E
FSTHSK
FLIIEQQSLPIFTVEGLEPYTLFNLSVTPYTYWGKGQKTSLSFRAPESVPSAPENPRIFILSS
G
RYTKKNEVVVEFRWNKPKHENGVLTKFEIFYHISKQSGTNRSTEDWMSASVIPPVMSFQLEAVSPEYTV
A
FQ
VRVFTSKGPGPFSDIVMSKTSEIKPCPYLISLLGNKIVFLDMDQNQVLWTFSLEGDVSTVGYTTDDE
M
GYFAQGDTLFLLNLRNHSSSK
LFQDALVSDIRVIAVDWIARHLYFALKASQNGTQIFNVDLEHKVKSPR
E
VKTCKAHTTIISFSIYPLL
SRLYWTEVSDLGHQMFYCNISNHTSQHVLQPKASNQHGRSQCSCNVTESE
L
SGAMTVDTSDPDRPWIYFTKRQEIWAMDLEGCQCWKVIMVPTIP
GKRIISLTVDGEFIYWIMKTKDDAQ
I
YQAKKGSGAILSQVKASRSKHILAYSSALQPFP
DKAYLSLASDMVEATILYATNTSLTLKLPPVKTNLT
W
HGITHPTSTYLIYYMEANRANSSDRRHKML
ESQENVARIEGLQPFSMYMIQIAVKNYYSEPLEHLPLGK
E
IQGQTKSG
VPGAVCHINATVLSDTSLHVFWTESHKPNGPKESVRYQLVMSYLAPIPETPLRQGEFPSAK
L
SLLITKLSGGQLYVMK
VLACHPEEMWCTESHPVSVNMFDTPEKPSALVPENTSLQLDWKARSNVNLTGF
W
FELQK
WKYNEFYHVKASCSQGPVYVCNITDLQPYTSYNIRVVVVYTTGENSSSIPESFKTKAGVPSKPG
I
PKLLEGSKNSIQWEKAEDNGSRLMYYTLEV
RKGISNDSQNQSSRWKVVFNGSCSSICTWRSKNLKGTFQ
F
RAVAANEIGLGEYSEISEDITLVE
DGVWITETSFILTIIVGIFLVATVPLTFVWHRSLKSHKASKEGLS
V
LNDNDKELAELRGLAAGVGLANACYAV
HTVPTQEEIENLPAFPREKLSLRLLLGSGAFGEVYEGTAIDI
L
GVGSGEIKVAVK
TLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLGEPQYIILELMEGGDLLSY
L
RKARGTT
FHGPSLTLLDLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSPRVVKIGDFGLAR
E
IYKNDYYRKRGEGLLPVRWMAPENLMDGIFTSQSDV
WSFGILVWEILTLGHQPYPAHSNLDVLNYVQAG
G
RLEPPRNCPDD
LWNLMSQCWAQEPDQRPTFHNIQNQLQLFRNVFLNNVSHCGEAAPTGGVINKGFEGED
D
EMVTLNSDDTMPVALMETKNQEGLNYMVLATKCSQGEGSYEGPLGPKELGSCDLKKDKKQPQADKDFCQ
E
PQVAYGSPGLSEGLNYACLAHSEHGDVSE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser