NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS23798.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23798.1 Public Mus musculus 10 Ddo 23 108 98 CCDS HistoryNCBI Gene:70503Re-query CCDS DB by CCDS ID:23798.1Re-query CCDS DB by GeneID:70503See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23798.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000019977.7 ENSMUSP00000019977.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000019977.7Link to Ensembl Protein Viewer:ENSMUSP00000019977.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000019977Re-query CCDS DB by Protein ID:ENSMUSP00000019977
Original member Current member NCBI NM_027442.5 NP_081718.2 Accepted alive Link to Nucleotide Sequence:NM_027442.5Link to Protein Sequence:NP_081718.2Re-query CCDS DB by Nucleotide ID:NM_027442Re-query CCDS DB by Protein ID:NP_081718Link to BLAST:NP_081718.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081718.2 341 Q922Z0 341 100% 0 0

Chromosomal Locations for CCDS 23798.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 40631609 40631780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 40632938 40633046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 40637345 40637521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 40647474 40648041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1026 nt):
ATGGACACAGTGTGTATTGCGGTCGTTGGAGCTGGCGTGATAGGGCTGTCTACTGCAGCATGCATTTCCC
AA
CTGGTTCCCGGATGCACCGTCACTGTCATCTCAGACAGGTTCACTCCTGATACCACCAGTAATGTAGC
G
GCTGGGATGCTTATTCCTCACACGTGTGCAGATACCCCGGTACCCACACAGAAGCGATGGTTTAGAGAG
ACC
TTCGAGCATCTTTCTGAAATCGCCAAGTCTGCAGAGGCTGCAGATGCGGGTGTTCACCTGGTATCTG
G
T
TGGCAGATATTCCGCAGCGTCCCCGCTGAAGAAGTGCCTTTCTGGGCTGATGTGGTGCTGGGATTTCG
A
AAGATGACAGAGGCTGAGCTGAAGCGGTTCCCTCAGTATGTGTTTGGCCAGGCTTTTACAACCCTGAAG
TGC
GAGACTTCTGCCTACCTCCCGTGGCTGGAGAGAAGGATAAAGGGGAGTGGAGGTCTGCTACTCACCA
GG
AGAATAGAAGACCTGTGGGAGCTGCAGCCATCTTTTGATATCGTGGTCAATTGCTCAGGCCTGGGAAG
C
CGGCGACTTGTAGGTGACCCCATGATTTCCCCGGTAAGGGGCCAGGTGCTCCAGGCACGGGCCCCCTGG
GTG
AAGCATTTCATCCGAGATGGGGGCGGGCTGACTTATGTTTACCCTGGTATGTCCTATGTAACCCTGG
GA
GGAACTAGACAGAAAGGAGACTGGAATCGATCCCCAGATGCAGAACTTAGCAGAGAGATTTTTTCTCG
A
TGCTGCACTCTCGAGCCTTCCCTCCACAGAGCCTACGACATAAAAGAGAAAGTGGGGCTGAGACCCAGC
AGG
CCAGGTGTGCGGCTGCAGAAGGAGATCCTAGTCCGGGGACAACAGACGCTGCCTGTGGTCCACAACT
AC
GGCCACGGGAGTGGGGGCATCTCTGTGCACTGGGGCTCTGCTCTGGAAGCCACCAGGCTGGTGATGGA
G
TGTATCCATACCCTCAGGACCCCTGCTTCCTTGTCGAAGCTGTAG


Translation (341 aa):
MDTVCIAVVGAGVIGLSTAACISQLVPGCTVTVISDRFTPDTTSNVAAGMLIPHTCADTPVPTQKRWFRE
T
FEHLSEIAKSAEAADAGVHLVS
GWQIFRSVPAEEVPFWADVVLGFRKMTEAELKRFPQYVFGQAFTTLK
C
ETSAYLPWLER
RIKGSGGLLLTRRIEDLWELQPSFDIVVNCSGLGSRRLVGDPMISPVRGQVLQARAPW
V
KHFIRDGGGLTYVYPGMSYVTLGGTRQKGDWNRSPDAELSREIFSRCCTLEPSLHRAYDIKEKVGLRPS
R
PGVRLQKEILVRGQQTLPVVHNYGHGSGGISVHWGSALEATRLVMECIHTLRTPASLSKL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser