NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23650.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23650.1 Public Mus musculus 9 1110059G10Rik 21 106 86 CCDS HistoryNCBI Gene:66202Re-query CCDS DB by CCDS ID:23650.1Re-query CCDS DB by GeneID:66202See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23650.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035154 ENSMUSP00000035154 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035154Link to Ensembl Protein Viewer:ENSMUSP00000035154Re-query CCDS DB by Nucleotide ID:ENSMUST00000035154Re-query CCDS DB by Protein ID:ENSMUSP00000035154
Original member Current member EBI,WTSI OTTMUST00000078841 OTTMUSP00000041961 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000078841Link to Vega Protein Viewer:OTTMUSP00000041961Re-query CCDS DB by Nucleotide ID:OTTMUST00000078841Re-query CCDS DB by Protein ID:OTTMUSP00000041961
Original member Current member NCBI NM_025419.4 NP_079695.2 Accepted alive Link to Nucleotide Sequence:NM_025419.4Link to Protein Sequence:NP_079695.2Re-query CCDS DB by Nucleotide ID:NM_025419Re-query CCDS DB by Protein ID:NP_079695Link to BLAST:NP_079695.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079695.2 155 Q8K039 155 100% 0 0

Chromosomal Locations for CCDS 23650.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 122947894 122948108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 122948925 122949069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 122950805 122950912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (468 nt):
ATGAGCAAGCGGAACCAAGTGTCCTATGTGCGGCCCGCAGAGCCCGCCTTCCTGTCCCGCTTCAAAGAGA
GA
GTCGGCTACAAGGAGGGGCCCACCGTAGAGACCAAGAAAATCCAGCCTCAGCTCCCAGATGAAGATGG
C
AATCACAGTGACAAAGAAGATGAACAGCCTCAAGTAGTGGTTTTAAAAAAGGGAGACCTAACAGCTGAA
GAG
GTCATGAAAATTAAAGCAGAAATAAAGGCTGCCAAAACAGATGAAGAACCACCTCCAGCTGATGGAA
GA
ATAGTTTATCGAAAACCAGTTAAGCGTTCCTCAGATGAAAAGTGTTCAGGTTTAACAGCAAGCTCCAA
A
AAGAAGAAAACCAATGAAGATGATGTAAATAAGCAAAGTTCAGTTAGAAAGAACTCACAAAAACAAATA
AAA
AATAGCAGTCTCCTTTCTTTTGACAGTGAAGATGAAAATGAGTAA


Translation (155 aa):
MSKRNQVSYVRPAEPAFLSRFKERVGYKEGPTVETKKIQPQLPDEDGNHSDKEDEQPQVVVLKKGDLTAE
E
VMKIKAEIKAAKT
DEEPPPADGRIVYRKPVKRSSDEKCSGLTASSKKKKTNEDDVNKQSSVRKNSQKQI
K
NSSLLSFDSEDENE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser