NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS23382.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23382.1 Public Mus musculus 9 Rwdd2a 23 108 98 CCDS HistoryNCBI Gene:69519Re-query CCDS DB by CCDS ID:23382.1Re-query CCDS DB by GeneID:69519See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23382.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000034988.9 ENSMUSP00000034988.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000034988.9Link to Ensembl Protein Viewer:ENSMUSP00000034988.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000034988Re-query CCDS DB by Protein ID:ENSMUSP00000034988
Original member Current member EBI ENSMUST00000179212.2 ENSMUSP00000137392.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000179212.2Link to Ensembl Protein Viewer:ENSMUSP00000137392.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000179212Re-query CCDS DB by Protein ID:ENSMUSP00000137392
Original member Current member EBI ENSMUST00000185566.6 ENSMUSP00000139930.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000185566.6Link to Ensembl Protein Viewer:ENSMUSP00000139930.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000185566Re-query CCDS DB by Protein ID:ENSMUSP00000139930
Original member Current member NCBI NM_001145968.1 NP_001139440.1 Accepted alive Link to Nucleotide Sequence:NM_001145968.1Link to Protein Sequence:NP_001139440.1Re-query CCDS DB by Nucleotide ID:NM_001145968Re-query CCDS DB by Protein ID:NP_001139440Link to BLAST:NP_001139440.1
Original member Current member NCBI NM_001145969.1 NP_001139441.1 Accepted alive Link to Nucleotide Sequence:NM_001145969.1Link to Protein Sequence:NP_001139441.1Re-query CCDS DB by Nucleotide ID:NM_001145969Re-query CCDS DB by Protein ID:NP_001139441Link to BLAST:NP_001139441.1
Original member Current member NCBI NM_027100.2 NP_081376.2 Accepted alive Link to Nucleotide Sequence:NM_027100.2Link to Protein Sequence:NP_081376.2Re-query CCDS DB by Nucleotide ID:NM_027100Re-query CCDS DB by Protein ID:NP_081376Link to BLAST:NP_081376.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001139440.1 292 Q9D9S3 292 99.6575% 0 1
NP_001139441.1 292 Q9D9S3 292 99.6575% 0 1
NP_081376.2 292 Q9D9S3 292 99.6575% 0 1

Chromosomal Locations for CCDS 23382.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 86572863 86573063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86573974 86574651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (879 nt):
ATGTCAGGGTCAGTAAAAGAAAGCCTTCAGCTTCAGCTGCTGGAGATGGAAATGCTGTTTTCTATGTTTC
CT
AATCAAGGAGAAGTAAAACTCGAAGATGTAAACGCCCTAACAAACATAAAGAGGTATCTGGAAGGCAC
C
AGGGAGGCGCTCCCACCCAACATCGAATTTGTCATCACGCTCCAAATTGAGGAGCCCAAGGTGACCATT
GAT
TTGCAAGTAACCATGCCTCACAACTACCCATACGTGGCTCTGCAGCTGTTTGGACGGTCACCTGAGC
TT
GACAGACAACAGCAGCTGCTGCTTAACCAAGCTCTCAGTGCTTATCTCGGGACTTTCGACCCAGGTGA
G
TTGTGTGTCTGTGCAGCCATCCAGTGGCTGCAGGACAACAGCGCATCCTACTTCCTCACCAGAAAGCTG
TCG
GACGAGCCATCCGTACAGGCGAAGCCAGTCAAGAACACATTCCTCCGCATGTGGATCTATAGCCACC
AC
ATATATCAGCAGGACCTGAGGAAAAAGATCTTGGAAGTGGGAAAAAGGTTAGATGTGACTGGATTTTG
C
ATGACAGGAAAGCCTGGTATAATCTGTGTGGAGGGCTTCAAGAATCACTGTGAGGAATTCTGGCACACA
ATC
AGATACCCCAATTGGAAACACATTTCCTGCAAGCATGCAGAAAGTGTGGAGACAGAGGGGGACGGTG
AA
GACCTGCGCCTCTTCCATTCGTTTGAGGAATTACTCCTTGAGGCCCATGGTGACTATGGATTGCGGAA
T
GATTATCACATGAACCTGGGCCAATTCCTGGAGTTTCTGAGAAAACACAAGAGTGAGCATGTTTTTCAG
ATA
TTATTTGGTATTGAAAGCAAAAGCTCAGAGTCCTAG


Translation (292 aa):
MSGSVKESLQLQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYLEGTREALPPNIEFVITLQIEEPKVTI
D
LQVTMPHNYPYVALQLFGRSPELDRQQQLLLNQALSAYLGTFDPGELCVCAAIQWLQDNSASYFLTRKL
S
DEPSVQAKPVKNTFLRMWIYSHHIYQQDLRKKILEVGKRLDVTGFCMTGKPGIICVEGFKNHCEEFWHT
I
RYPNWKHISCKHAESVETEGDGEDLRLFHSFEELLLEAHGDYGLRNDYHMNLGQFLEFLRKHKSEHVFQ
I
LFGIESKSSES




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser