NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS23109.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23109.1 Public Mus musculus 9 Trappc4 21 106 86 CCDS HistoryNCBI Gene:60409Re-query CCDS DB by CCDS ID:23109.1Re-query CCDS DB by GeneID:60409See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 23109.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000034623 ENSMUSP00000034623 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000034623Link to Ensembl Protein Viewer:ENSMUSP00000034623Re-query CCDS DB by Nucleotide ID:ENSMUST00000034623Re-query CCDS DB by Protein ID:ENSMUSP00000034623
Original member Current member NCBI NM_021789.2 NP_068561.1 Accepted alive Link to Nucleotide Sequence:NM_021789.2Link to Protein Sequence:NP_068561.1Re-query CCDS DB by Nucleotide ID:NM_021789Re-query CCDS DB by Protein ID:NP_068561Link to BLAST:NP_068561.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_068561.1 219 Q9ES56 219 100% 0 0

Chromosomal Locations for CCDS 23109.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 44404020 44404098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44404334 44404460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44405243 44405346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44406804 44406978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44407127 44407301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (660 nt):
ATGGCGATTTTTAGCGTGTACGTGGTGAACAAAGCCGGCGGCCTGATTTACCAGTGGGACAGCTATTCGC
CA
CGGGCTGAGGCTGAGAAGACTTTCAGTTACCCGCTGGACCTGCTGCTGAAACTGCACGACGAACGCGT
G
CTGGTCGCTTTCGGCCAGCGCGACGGCATCCGGGTGGGCCATGCAGTGTTGGCCATCAATGGCATGGAC
GTG
AATGGCAAGTACACGGCTGACGGGAAAGAAGTGCTGGAGTATCTGGGTAACCCTGCGAATTACCCGG
TT
TCCATCCGATTCGGCCGGCCCCGCCTTACCTCTAACGAGAAGCTTATGCTGGCCTCGATGTTCCACTC
G
CTCTTTGCCATTGGTTCCCAGCTATCTCCGGAACAGGGCAGTTCAGGCATTGAGATGCTGGAAACAGAC
ACC
TTCAAACTGCACTGCTTCCAAACACTGACAGGGATCAAGTTTGTGGTCCTGGCAGACCCTAGGCAAG
CT
GGAATAGATTCTCTTCTCCGAAAAATTTATGAAATTTACTCAGACTTTGCCCTCAAGAATCCATTCTA
C
TCCTTGGAAATGCCTATCAGATGCGAGCTGTTTGATCAAAACCTGAAGCTAGCTCTAGAGGTGGCAGAG
AAG
GCTGGCACTTTTGGACCTGGGTCATAG


Translation (219 aa):
MAIFSVYVVNKAGGLIYQWDSYSPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMD
V
NGKYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFH
SLFAIGSQLSPEQGSSGIEMLETD
T
FKLHCFQTLT
GIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAE
K
AGTFGPGS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser