NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS22942.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22942.1 Public Mus musculus 9 Opcml 21 106 86 CCDS HistoryNCBI Gene:330908Re-query CCDS DB by CCDS ID:22942.1Re-query CCDS DB by GeneID:330908See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22942.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000115243 ENSMUSP00000110898 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115243Link to Ensembl Protein Viewer:ENSMUSP00000110898Re-query CCDS DB by Nucleotide ID:ENSMUST00000115243Re-query CCDS DB by Protein ID:ENSMUSP00000110898
Original member Current member EBI,WTSI OTTMUST00000058899 OTTMUSP00000028602 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000058899Link to Vega Protein Viewer:OTTMUSP00000028602Re-query CCDS DB by Nucleotide ID:OTTMUST00000058899Re-query CCDS DB by Protein ID:OTTMUSP00000028602
Original member NCBI NM_177906.4 NP_808574.2 Updated not alive Link to Nucleotide Sequence:NM_177906.4Link to Protein Sequence:NP_808574.2Re-query CCDS DB by Nucleotide ID:NM_177906Re-query CCDS DB by Protein ID:NP_808574
Current member NCBI NM_177906.5 NP_808574.2 Accepted alive Link to Nucleotide Sequence:NM_177906.5Link to Protein Sequence:NP_808574.2Re-query CCDS DB by Nucleotide ID:NM_177906Re-query CCDS DB by Protein ID:NP_808574Link to BLAST:NP_808574.2

Chromosomal Locations for CCDS 22942.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 27791386 27791446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 28404328 28404412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 28675134 28675366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 28813287 28813412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 28901519 28901653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 28902055 28902175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 28903215 28903366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 28920087 28920187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1014 nt):
ATGTACCATCCCGCCTACTGGATCGTCTTCTCGGCCACCACTGCCCTGCTCTTCATCCCAGGAGTGCCGG
TG
CGCAGCGGAGATGCCACCTTTCCCAAAGCTATGGACAACGTGACGGTCCGGCAGGGGGAGAGCGCCAC
C
CTCAGGTGTACCATAGATGATCGGGTCACCCGGGTAGCCTGGCTAAACCGCAGCACAATCCTCTATGCT
GGG
AATGACAAGTGGTCCATAGACCCTCGAGTGATCATTTTGGTCAACACGCCTACCCAATACAGTATCA
TG
ATCCAGAATGTGGATGTATACGATGAAGGTCCATACACCTGCTCTGTGCAGACAGACAATCACCCCAA
A
ACCTCCCGGGTCCATCTCATAGTGCAAGTTCCTCCCCAGATAATGAACATCTCGTCAGACATTACCGTG
AAT
GAAGGAAGCAGTGTGACCCTGTTATGTCTTGCAATTGGCAGACCAGAACCAACGGTGACATGGAGGC
AC
CTGTCAGTCAAGGGCCAGGGATTTGTGAGTGAAGATGAATACCTGGAAATCTCAGACATCAAACGTGA
C
CAGTCTGGGGAGTACGAGTGCAGCGCCTTGAATGACGTCGCTGCACCTGATGTTCGGAAAGTAAAAATC
ACT
GTAAACTACCCTCCCTATATATCTAAAGCCAAGAACACTGGTGTTTCAGTGGGTCAGAAGGGCATCT
TG
AGCTGCGAAGCCTCTGCTGTCCCGATGGCTGAATTCCAGTGGTTCAAAGAAGATACCAGGTTAGCCAC
T
GGCCTGGATGGGGTGAGAATTGAGAACAAAGGCCGCATATCCACTTTGACTTTCTTCAATGTCTCAGAG
AAG
GATTATGGGAACTATACCTGTGTGGCCACAAACAAGCTTGGGAACACCAATGCCAGCATCACCCTGT
AT
GGGCCTGGAGCAGTGATTGATGGTGTAAACTCGGCCTCCAGAGCACTGGCTTGTCTCTGGCTCTCAGG
G
ACCTTCTTTGCCCACTTCTTCATCAAGTTTTGA


Translation (337 aa):
MYHPAYWIVFSATTALLFIPGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYA
G
NDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQ
VPPQIMNISSDITV
N
EGSSVTLLCLAIGRPEPTVTWRHLSVK
GQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKI
T
VN
YPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRISTLTFFNVSE
K
DYGNYTCVATNKLGNTNASITLY
GPGAVIDGVNSASRALACLWLSGTFFAHFFIKF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser