NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS2292.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2292.1 Public Homo sapiens 2 ITGAV 22 109 92 CCDS HistoryNCBI Gene:3685Re-query CCDS DB by CCDS ID:2292.1Re-query CCDS DB by GeneID:3685See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2292.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000261023.7 ENSP00000261023.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000261023.7Link to Ensembl Protein Viewer:ENSP00000261023.3Re-query CCDS DB by Nucleotide ID:ENST00000261023Re-query CCDS DB by Protein ID:ENSP00000261023
Original member NCBI NM_002210.4 NP_002201.1 Updated not alive Link to Nucleotide Sequence:NM_002210.4Link to Protein Sequence:NP_002201.1Re-query CCDS DB by Nucleotide ID:NM_002210Re-query CCDS DB by Protein ID:NP_002201
Current member NCBI NM_002210.5 NP_002201.2 Accepted alive Link to Nucleotide Sequence:NM_002210.5Link to Protein Sequence:NP_002201.2Re-query CCDS DB by Nucleotide ID:NM_002210Re-query CCDS DB by Protein ID:NP_002201Link to BLAST:NP_002201.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002201.2 1048 P06756-1 1048 100% 0 0

Chromosomal Locations for CCDS 2292.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 186590339 186590523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186602021 186602151 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186622339 186622430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186625473 186625587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186630797 186630858 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186633329 186633374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186636082 186636207 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186637065 186637109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186638277 186638320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186638409 186638465 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186640915 186640967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186641386 186641588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186646686 186646877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186649840 186649885 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186651982 186652089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186654650 186654708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186656247 186656401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186659038 186659175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186663768 186663835 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186664494 186664641 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186665126 186665218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186666704 186666783 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186667150 186667230 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186667671 186667776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186668762 186668920 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186669701 186669814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186675604 186675717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186675820 186675927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186676813 186676935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 186677197 186677292 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3147 nt):
ATGGCTTTTCCGCCGCGGCGACGGCTGCGCCTCGGTCCCCGCGGCCTCCCGCTTCTTCTCTCGGGACTCC
TG
CTACCTCTGTGCCGCGCCTTCAACCTAGACGTGGACAGTCCTGCCGAGTACTCTGGCCCCGAGGGAAG
T
TACTTCGGCTTCGCCGTGGATTTCTTCGTGCCCAGCGCGTCTTCCCGGATGTTTCTTCTCGTGGGAGCT
CCC
AAAGCAAACACCACCCAGCCTGGGATTGTGGAAGGAGGGCAGGTCCTCAAATGTGACTGGTCTTCTA
CC
CGCCGGTGCCAGCCAATTGAATTTGATGCAACAGGCAATAGAGATTATGCCAAGGATGATCCATTGGA
A
TTTAAGTCCCATCAGTGGTTTGGAGCATCTGTGAGGTCGAAACAGGATAAAATTTTGGCCTGTGCCCCA
TTG
TACCATTGGAGAACTGAGATGAAACAGGAGCGAGAGCCTGTTGGAACATGCTTTCTTCAAGATGGAA
CA
AAGACTGTTGAGTATGCTCCATGTAGATCACAAGATATTGATGCTGATGGACAGGGATTTTGTCAAGG
A
GGATTCAGCATTGATTTTACTAAAGCTGACAGAGTACTTCTTGGTGGTCCTGGTAGCTTTTATTGGCAA
G
GT
CAGCTTATTTCGGATCAAGTGGCAGAAATCGTATCTAAATACGACCCCAATGTTTACAGCATCAAGT
AT
AATAACCAATTAGCAACTCGGACTGCACAAGCTATTTTTGATGACAGCTATTTGGGTTATTCTGTGGC
T
GTCGGAGATTTCAATGGTGATGGCATAGATGACTTTGTTTCAGGAGTTCCAAGAGCAGCAAGGACTTTG
GGA
ATGGTTTATATTTATGATGGGAAGAACATGTCCTCCTTATACAATTTTACTGGCGAGCAGATGGCTG
CA
TATTTCGGATTTTCTGTAGCTGCCACTGACATTAATGGAGATGATTATGCAGATGTGTTTATTGGAGC
A
CCTCTCTTCATGGATCGTGGCTCTGATGGCAAACTCCAAGAGGTGGGGCAGGTCTCAGTGTCTCTACAG
AGA
GCTTCAGGAGACTTCCAGACGACAAAGCTGAATGGATTTGAGGTCTTTGCACGGTTTGGCAGTGCCA
TA
GCTCCTTTGGGAGATCTGGACCAGGATGGTTTCAATGATATTGCAATTGCTGCTCCATATGGGGGTGA
A
GATAAAAAAGGAATTGTTTATATCTTCAATGGAAGATCAACAGGCTTGAACGCAGTCCCATCTCAAATC
CTT
GAAGGGCAGTGGGCTGCTCGAAGCATGCCACCAAGCTTTGGCTATTCAATGAAAGGAGCCACAGATA
TA
GACAAAAATGGATATCCAGACTTAATTGTAGGAGCTTTTGGTGTAGATCGAGCTATCTTATACAGGGC
C
AGACCAGTTATCACTGTAAATGCTGGTCTTGAAGTGTACCCTAGCATTTTAAATCAAGACAATAAAACC
TGC
TCACTGCCTGGAACAGCTCTCAAAGTTTCCTGTTTTAATGTTAGGTTCTGCTTAAAGGCAGATGGCA
AA
GGAGTACTTCCCAGGAAACTTAATTTCCAGGTGGAACTTCTTTTGGATAAACTCAAGCAAAAGGGAGC
A
ATTCGACGAGCACTGTTTCTCTACAGCAGGTCCCCAAGTCACTCCAAGAACATGACTATTTCAAGGGGG
GGA
CTGATGCAGTGTGAGGAATTGATAGCGTATCTGCGGGATGAATCTGAATTTAGAGACAAACTCACTC
CA
ATTACTATTTTTATGGAATATCGGTTGGATTATAGAACAGCTGCTGATACAACAGGCTTGCAACCCAT
T
CTTAACCAGTTCACGCCTGCTAACATTAGTCGACAGGCTCACATTCTACTTGACTGTGGTGAAGACAAT
GTC
TGTAAACCCAAGCTGGAAGTTTCTGTAGATAGTGATCAAAAGAAGATCTATATTGGGGATGACAACC
CT
CTGACATTGATTGTTAAGGCTCAGAATCAAGGAGAAGGTGCCTACGAAGCTGAGCTCATCGTTTCCAT
T
CCACTGCAGGCTGATTTCATCGGGGTTGTCCGAAACAATGAAGCCTTAGCAAGACTTTCCTGTGCATTT
AAG
ACAGAAAACCAAACTCGCCAGGTGGTATGTGACCTTGGAAACCCAATGAAGGCTGGAACTCAACTCT
TA
GCTGGTCTTCGTTTCAGTGTGCACCAGCAGTCAGAGATGGATACTTCTGTGAAATTTGACTTACAAAT
C
CAAAGCTCAAATCTATTTGACAAAGTAAGCCCAGTTGTATCTCACAAAGTTGATCTTGCTGTTTTAGCT
GCA
GTTGAGATAAGAGGAGTCTCGAGTCCTGATCATGTCTTTCTTCCGATTCCAAACTGGGAGCACAAGG
AG
AACCCTGAGACTGAAGAAGATGTTGGGCCAGTTGTTCAGCACATCTATGAGCTGAGAAACAATGGTCC
A
AGTTCATTCAGCAAGGCAATGCTCCATCTTCAGTGGCCTTACAAATATAATAATAACACTCTGTTGTAT
ATC
CTTCATTATGATATTGATGGACCAATGAACTGCACTTCAGATATGGAGATCAACCCTTTGAGAATTA
AG
ATCTCATCTTTGCAAACAACTGAAAAGAATGACACGGTTGCCGGGCAAGGTGAGCGGGACCATCTCAT
C
ACTAAGCGGGATCTTGCCCTCAGTGAAGGAGATATTCACACTTTGGGTTGTGGAGTTGCTCAGTGCTTG
AAG
ATTGTCTGCCAAGTTGGGAGATTAGACAGAGGAAAGAGTGCAATCTTGTACGTAAAGTCATTACTGT
GG
ACTGAGACTTTTATGAATAAAGAAAATCAGAATCATTCCTATTCTCTGAAGTCGTCTGCTTCATTTAA
T
GTCATAGAGTTTCCTTATAAGAATCTTCCAATTGAGGATATCACCAACTCCACATTGGTTACCACTAAT
GTC
ACCTGGGGCATTCAGCCAGCGCCCATGCCTGTGCCTGTGTGGGTGATCATTTTAGCAGTTCTAGCAG
GA
TTGTTGCTACTGGCTGTTTTGGTATTTGTAATGTACAGGATGGGCTTTTTTAAACGGGTCCGGCCACC
T
CAAGAAGAACAAGAAAGGGAGCAGCTTCAACCTCATGAAAATGGTGAAGGAAACTCAGAAACTTAA


Translation (1048 aa):
MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGA
P
KANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDAT
GNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAP
L
YHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRS
QDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQ
G
QLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTL
G
M
VYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQ
R
ASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFN
DIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
L
EGQWAARSMPPSFGYSMKGATDIDKNGYP
DLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKT
C
SLPGTALKVS
CFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRG
G
LMQCEELIAYLR
DESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDN
V
CKPKLEVSVD
SDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAF
K
TENQTRQVVCDLGNPMKAGTQ
LLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLA
A
VEIR
GVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
I
LHYDIDGPMNCTSDMEINPLRIK
ISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCL
K
IVCQVGRLDRGKSAILYVKSLLWTETFMN
KENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTN
V
TWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYR
MGFFKRVRPPQEEQEREQLQPHENGEGNSET



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser