NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS22670.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22670.1 Public Mus musculus 8 Pdpr 23 108 98 CCDS HistoryNCBI Gene:319518Re-query CCDS DB by CCDS ID:22670.1Re-query CCDS DB by GeneID:319518See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 22670.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000039333.9 ENSMUSP00000046639.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000039333.9Link to Ensembl Protein Viewer:ENSMUSP00000046639.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000039333Re-query CCDS DB by Protein ID:ENSMUSP00000046639
Original member Current member NCBI NM_198308.1 NP_938050.1 Accepted alive Link to Nucleotide Sequence:NM_198308.1Link to Protein Sequence:NP_938050.1Re-query CCDS DB by Nucleotide ID:NM_198308Re-query CCDS DB by Protein ID:NP_938050Link to BLAST:NP_938050.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_938050.1 878 Q7TSQ8 878 100% 0 0

Chromosomal Locations for CCDS 22670.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 111101867 111102090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111103904 111104037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111112502 111112583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111112687 111112850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111114742 111114863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111115124 111115241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111116682 111116831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111117967 111118159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111121148 111121272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111123745 111123900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111124479 111124612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111125605 111125753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111126216 111126328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111128243 111128337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111129606 111129695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111132877 111133059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 111134608 111135012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2637 nt):
ATGCTTTACCGGTTGCTCTCTATTGTGCAAAGACAAAGGACTAGCCCAGGATGGCAGACCTGGTCATCAG
CG
AGAAGCAGCACGTCCACTGCGGAGGCACATTCTATTGCTCTGCCTGCCCAGGCCCAGGTGGTCATCTG
T
GGAGGTGGAATCATGGGTACATCCGTGGCCTATCACCTCTCCAAAATGGGATGGCAAGATATTGTCCTT
TTG
GAGCAGGGCAGGCTGGCTGCTGGCTCAACAAGGTTCTGTGCTGGCATCCTAAGCACTGCTAGGCATT
CA
AGCGTTGAGCAGAAGATGGCTAACTATTCAAACAAACTCTACCATCAGTTAGAACAAGAAACAGGGAT
C
CAAACAGGTTACTTAAGGACAGGCTCAATCTCTCTGGCCCAGACTCAGGACCGGTTGATCTCTCTGAAG
CGT
ATCAACTCAAGGCTGAATGTTGTAGGTATCCCTTCTGAGATCATCTCCCCGAAGAAAGTGGCTGAAC
TT
CACCCTCTCCTCAATGTGCATGATCTGGTCGGGGCCATGTACGTTCCTGAGGATGCAGTAGTGTCCTC
T
GCTGATGTGGCTCTGGCCCTGGCAAGTGCTGCCTCCCAGAATGGTGTTCAGATTTATGACCGGACAAGT
GTT
CTTCACGTACTGATCAAAAAAGGTCAAGTTACTGGTGTGGAGACAGACAAAGGACAGATCGAATGCC
AG
TATTTTGTCAACTGTGCCGGGCAGTGGGCATATGAGCTGGGTCTGTCCAACGAGGAGCCGCTTAGTAT
C
CCGCTACACGCCTGTGAACACTTCTACCTTCTGACTCGTCCCTGGGACACCCCTCTGCAGAGCAACACA
CCA
ACCATTGTGGATGCTGATGGAAGAATTTACATTAGGAACTGGCAGGGTGGCATCTTGTCTGGAGGCT
TT
GAGAAGAACCCCAAACCTATTTTCACTGAAGGCAAGAACCAGTTGGAAATTCAGAACCTTCGTGAAGA
C
TGGGATCACTTTGAGCCCCTGCTGAGTTCCCTCCTGCGTAGGATGCCAGCATTGGAGACTCTGGAGATT
TTG
AAGTTGGTGAATTGCCCTGAGACCTTCACACCAGACATGAAGTGCATCATGGGCGAGTCTCCTGTAG
TA
CAGGGCTACTTTGTCCTGGCAGGGATGAACTCTGCTGGCCTGTCGTTGGGTGGAGGAGCTGGAAAGTT
C
CTAGCAGAATGGATGGTATATGGTTATCCCTCTGAAAATGTCTGGGAGTTGGATTTGCAGCGCTTCGGA
GCC
CTCCAGAGCAGCCGCACCTTTCTGCGCCACCGGGTCATGGAAGTTATGCCTCTGATATATGATCTGA
AG
GTTCCCCGTTGGGATTTCCAGACTGGAAGGCAGTTACGTACATCTCCTCTTTATGACCGGCTGGATGC
T
CAAGGAGCCAGATGGATGGAGAAACATGGATTTGAGAGGCCAAAGTACTTTGTTCCACCCAACAAGGAC
CTT
CTTGCATTAGAACAGAGCAAGACTTTCTACAAGCCAGATTGGTTTGATATTGTGGAGTCAGAAGTCA
AA
TGCTGCAAGGAAGCTGTGTGTGTCATTGACATGTCCTCTTTCACAAAATTTGAAATAACTTCCACTGG
G
GACGAGGCGTTAGAAAGTCTGCAGTACCTTTTCTGCAATGACCTTGATGTACCTGTAGGCCACATCGTT
CAT
ACTGGCATGCTCAATGAATATGGAGGATACGAAAACGACTGCAGCATCGCACGCCTGACCAAACGCA
G
T
TTCTTTATGATTTCTCCAACCGATCAGCAGGTCCACTGTTGGGCCTGGCTTAACAAATACTTGCCGAA
A
GACAGCAACTTGCTGCTGGAGGACGTCACCTGGAAATACACAGCCCTCAATCTGATTGGCCCTCGAGCC
GTG
GATGTGCTATCTGAGCTGTCCTATGCCCCTATGACTCCAGATCACTTTCCAACGCTCTTCTGCAAGG
AG
ATGAGTGTGGGCTATGCAAATGGGATCCGGGTGATGAGTATGACGCACACGGGAGAGCCAGGCTTCAT
G
CTGTATATCCCCATAGAGTACGCTCTGCATGTCTACAATGAGGTGATGAGTGTTGGACAGAAATATGGA
ATC
CGGAATGCTGGGTATTATGCCCTCAGAAGTCTCCGAATTGAGAAGTTTTTTGCTTTCTGGGGTCAGG
AC
TTAAACACCCTTACCACGCCTTTGGAATGTGGAGGAGAATCTCGAGTGAAGTTAGAGAAGGGCATAGA
C
TTCATTGGTCGGGATGCCCTGCTGCAGCAGAAGCAGACCGGGGTATATAAGCGCCTTGCTATGTTCATT
CTG
GACGACCATGACACAGACCTTGATTTGTGGCCTTGGTGGGGAGAACCCATTTACCGGAACGGAAAGT
AT
GCTGGCAAGACCACCAGTAGTGCCTATAGCTACACACTGGAGCGCCATGTATGCCTGGGTTATGTACA
C
AATTTTTCTGAGGACAGTGGGGAAGAGCAGGTGGTGACAACAGATTTCATCAACCGAGGAGAATATGAA
ATT
GACATTGCAGGACATCGGTTTCAGGCCAAGGCCAAGCTCTACCCTGTCACCTCTTTTTTCACTCACA
AG
CGTAGAAAGGACGATGTGGAGCTGAGCGACTTTCATGGGAAGTAA


Translation (878 aa):
MLYRLLSIVQRQRTSPGWQTWSSARSSTSTAEAHSIALPAQAQVVICGGGIMGTSVAYHLSKMGWQDIVL
L
EQG
RLAAGSTRFCAGILSTARHSSVEQKMANYSNKLYHQLEQETGIQTGYLRTGSISLAQTQDRLISLK
R
INSRL
NVVGIPSEIISPKKVAELHPLLNVHDLVGAMYVPEDAVVSSADVALALASAASQNGVQIYDRTS
V
LHVLIKKGQVTGVETDKGQIECQYFVNCAGQ
WAYELGLSNEEPLSIPLHACEHFYLLTRPWDTPLQSNT
P
TIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLREDWDHFEPLLSSLLRRMPALETLEI
L
KLVNCPETFTPDMKCIMGESPVVQGYFVLAGMNSAGLSLGGGAG
KFLAEWMVYGYPSENVWELDLQRFG
A
LQSSRTFLRHRVMEVM
PLIYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFERPKYFVPPNKD
L
LALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEIT
STGDEALESLQYLFCNDLDVPVGHIV
H
TGMLNEYGGYENDCSIARLTKR
SFFMISPTDQQVHCWAWLNKYLPKDSNLLLEDVTWKYTALNLIGPRA
V
DVLSELSYAPMTPDHFPTLFCK
EMSVGYANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYG
I
RNAGYYALRSLRIEKFFAFWGQDLNTLTTPLECGGESRVKLEK
GIDFIGRDALLQQKQTGVYKRLAMFI
L
DDHDTDLDLWPWWGEPIYRNGKYAGKTTSSAYSYTLERHVCLGYVHNFSEDSGEEQVVTTDFINRGEYE
I
DIAGHRFQAKAKLYPVTSFFTHKRRKDDVELSDFHGK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser