NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS22651.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22651.1 Public Mus musculus 8 Zfhx3 21 106 86 CCDS HistoryNCBI Gene:11906Re-query CCDS DB by CCDS ID:22651.1Re-query CCDS DB by GeneID:11906See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22651.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000043896 ENSMUSP00000044612 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000043896Link to Ensembl Protein Viewer:ENSMUSP00000044612Re-query CCDS DB by Nucleotide ID:ENSMUST00000043896Re-query CCDS DB by Protein ID:ENSMUSP00000044612
Original member Current member EBI,WTSI OTTMUST00000107189 OTTMUSP00000059856 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000107189Link to Vega Protein Viewer:OTTMUSP00000059856Re-query CCDS DB by Nucleotide ID:OTTMUST00000107189Re-query CCDS DB by Protein ID:OTTMUSP00000059856
Original member Current member NCBI NM_007496.2 NP_031522.2 Accepted alive Link to Nucleotide Sequence:NM_007496.2Link to Protein Sequence:NP_031522.2Re-query CCDS DB by Nucleotide ID:NM_007496Re-query CCDS DB by Protein ID:NP_031522Link to BLAST:NP_031522.2

Chromosomal Locations for CCDS 22651.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 108792248 108794969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 108800195 108800691 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 108856722 108856953 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 108914522 108914629 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 108933532 108933665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 108933809 108934009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 108945102 108945204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 108946317 108951770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 108955382 108957102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (11172 nt):
ATGGAAGGCTGTGACTCGCCCGTCGTCTCGGGGAAGGACAATGGGTGCGGGATCCCTCAGCACCGGCAAT
GG
ACTGAACTCAACAGCGCCCACCTCCCCGACAAACCCAGTAGCATGGAGCAGCCCACAGGCGAGAGCCA
T
GGGCCCCTGGACAGCCTGAGGGCCCCCTTCAATGAGCGCCTGGCGGACAGCAGCACCTCCGCTGGGCCG
CCC
GCCGAGCCCGCCAGCAAGGAGGTCAGCTGCAACGAGTGCTCAGCCTCCTTTTCCAGCCTCCAGACCT
AC
ATGGAGCATCACTGCCCTGGCACGCATCCCCCGCCGGCCCTGCGAGAGGAGAGCGCCAGCGACACCAG
C
GAGGAGGGCGAGGAGGAGAGCGATGTGGAGAACCTGGCCGGGGAGATCGTCTACCAGCCAGACGGCTCC
GCG
TACATTGTTGAGAGCCTGAGCCAGCTGGCCCAGAGCGGGGCCGCGTGTGGCAGCAGCAGCGGCAGCG
GG
GCTGTCCCCTCGCTCTTCCTGAACTCTCTCCCAGGGGTGGGGGGGAAACAAGGGGACCCTTCGTGTGC
T
GCACCCGTGTACCCGCAGATCATCAACACTTTCCACATAGCCTCATCCTTCGGGAAATGGTTTGAAGGC
TCA
GACCCGGCCTTCCCGAATACCTCAGCCCTGGCGGGGCTCAGCCCTGTCCTGCACAGCTTCCGCGTTT
TT
GACGTGCGACACAAAAGCAACAAGGATTACCTGAACAGCGATGGTTCTGCCAAAAGCTCCTGCGTATC
C
AAAGATGTTCCCAACAATGTGGACCTGTCCAAATTCGATGGCTTTGTGCTCTACGGCAAGAGGAAACCC
ATT
TTGATGTGTTTCCTGTGCAAACTCTCCTTTGGGTATGTGCGTTCATTTGTGACCCACGCGGTGCACG
AC
CATCGAATGACCCTGAGCGAAGAGGAGCGGAAACTTCTTAGCAATAAGAACATCTCCGCTATCATCCA
A
GGGATTGGCAAAGACAAGGAACCCCTTGTAAGTTTTCTGGAACCAAAAAACAAAAACTTTCAACACCCT
TTA
GTTTCCACAGCTAACCTCATAGGCCCCGGACACAGTTTTTATGGTAAATTTAGTGGCATTCGCATGG
AA
GGGGAGGAGGCCCTCCCAGCCGTAGCCGCTGCTGGCCCTGAGCAGCCCCAGGCTGGTCTCTTGACCCC
C
AGCACCCTCTTGAACCTTGGCGGGCTTACCAGCTCGGTCCTGAAGACCCCCATTACCTCAGTCCCCCTG
GGG
CCTCTGGCTTCTAGTCCTACCAAATCCTCAGAGGGCAAGGACTCTGGGGCAGCTGAAGGAGATAAGC
AA
GAATCGGGGGGTCATCAGGACTGCTTCTCCGAGAAAGTAGAGCCAGCCGAGGAAGAGGAGGCAGAAGA
G
GAGGAAGAGGAGGAGGAAGAGGCGGAGGAGGAGGAGGAAGAGGAGGAGGAAGAAGAGGAAGAGGAAGAG
GAG
GGCTGCAAAGGACTCTTTCCAAATGACCTGGAGGAGGAGCTGGAGGACAGGCCCTCCGAGGAGTCTG
GG
GCCCCCGCAGGTGGTAGCAGCAAAAAGGACCTTGCTCTCTCAAACCAAAGCATTTCTAACTCCCCCTT
A
ATGCCTAATGTGCTCCAGACCCTGTCGAGGGGCCCAGCTTCTACTACTTCTAACTCTGCTTCTAACTTT
GTT
GTCTTTGATGGTGCGAACAGGAGGAGTCGTTTAAGCTTTAACAGTGAGGGCGTCAGGGCCAACGTGG
CA
GAGGGCAGGAGGCTGGACTTCGCTGACGAAAGTGCCAATAAAGACAGTGCCACAGCACCAGAACCAAA
T
GAAAGCACAGAGGGCGATGATGGGGGCTTTGTCCCTCATCACCAGCACGCTGGCTCCCTCTGCGAGCTT
GGG
GTCGGGGAGTGCCCCTCAGGTAGCGGTGTGGAGTGCCCCAAATGTGACACGGTCCTGGGCTCCTCAC
GC
TCGCTGGGCGGCCACATGACCATGATGCATTCTCGTAACTCGTGTAAGACGCTCAAGTGCCCCAAGTG
C
AACTGGCACTATAAGTACCAGCAGACACTGGAGGCGCACATGAAGGAGAAGCACCCGGAGCCAGGGGGC
TCC
TGCGTCTACTGCAAAAGCGGGCAGCCCCACCCGCGCTTGGCACGAGGCGAGAGCTACACGTGTGGTT
AC
AAGCCTTTCCGCTGCGAGGTGTGTAACTACTCCACAACTACCAAAGGCAACCTCAGTATTCATATGCA
G
TCCGACAAACATCTCAACAACATGCAGAACCTGCAGAACGGAGGGGGCGAGCAGGTCTTCAGCCACAGC
GCC
GGGGCCGCGGCCGCCGCCGCAGCTGCAGCAGCGGCCGCCGCCAACATCGGCAGCTCCTGCGGTGCCC
CC
TCCCCCACCAAACCAAAAACCAAACCCACGTGGCGGTGTGAGGTGTGCGACTACGAGACCAACGTGGC
C
AGGAACCTCCGCATTCACATGACCAGTGAGAAACACATGCACAACATGATGCTGCTTCAACAGAACATG
ACC
CAGATCCAGCACAACCGCCACCTGGGGCTCGGCAGCCTCCCCTCGCCCGCTGAGGCTGAGCTCTACC
AG
TACTACCTGGCCCAGAACATGAACCTGCCCAACCTGAAGATGGACAGTACCGCTTCGGATGCCCAGTT
C
ATGATGAGTGGATTCCAGCTGGATCCTACAGGGCCCATGGCCGCCATGACGCCTGCTCTAGTGGGCGGT
GAG
ATCCCCCTCGACATGCGCCTCGGGGGCGGGCAGCTGGTGTCGGAGGAGCTGATGAACCTGGGCGAGA
GC
TTCATCCAGACCAACGACCCATCGCTGAAGCTCTTCCAATGTGCCGTCTGCAACAAGTTCACGACGGA
C
AACCTGGACATGCTGGGGCTGCACATGAACGTGGAGCGCAGCCTCTCGGAGGACGAGTGGAAGGCCGTG
ATG
GGGGACTCTTACCAGTGCAAGCTCTGCCGCTACAACACGCAGCTCAAGGCCAACTTCCAGCTGCACT
GC
AAGACGGACAAGCACGTGCAGAAGTACCAGCTGGTGGCCCACATCAAGGAGGGTGGCAAGGCCAATGA
G
TGGAGGCTCAAGTGTGTGGCCATCGGCAACCCTGTGCACCTGAAGTGCAACGCTTGTGACTACTACACC
AAT
AGCCTGGAGAAGCTGCGGCTGCACACAGTCAACTCCAGGCACGAGGCCAGCCTGAAGCTGTACAAGC
AC
CTGCAGCAGCATGAGAGTGGCGTGGAGGGTGAGAGCTGCTACTACCACTGTGTCCTGTGCAACTACTC
C
ACCAAGGCCAAGCTCAACCTCATCCAGCACGTGCGCTCCATGAAGCACCAGCGCAGTGAGAGCCTGCGC
AAG
CTGCAGCGGCTGCAGAAGGGCCTCCCGGAGGAGGACGAGGACCTGGGCCAGATCTTCACCATCCGCA
GG
TGCCCCTCCACTGACCCAGAGGAAGCCGTTGAAGATGCCGAAGGACCCAGCGAAGCATCTGCTGACCC
A
GAGGAGCTGGCCAAAGACCAGGGGAGCGGCAGCGAGGAAGGGCAGAGCAAGAGGGCAGCGTCATCCAGT
CAG
GCAGAGAAGGAGTTGACGGATTCCCCTGCAACCACCAAACGCACCTCCTTCCCGGGTAGCTCTGAGA
CT
CCGCTCTCTTCGAAGAGGCCAAAAGCATCAGAGGAGATCAAACCCGAGCAGATGTACCAGTGTCCCTA
C
TGCAAGTATAGCAACGCTGACGTGAACCGGCTGCGGGTGCACGCCATGACACAGCACTCGGTGCAGCCT
TTG
CTCCGCTGTCCCCTGTGCCAAGACATGCTCAACAACAAGATCCACCTCCAGCTGCACCTCACCCACC
TC
CACAGCGTGGCACCTGACTGCGTGGAGAAGCTCATTATGACGGTGACCGCTCCTGAGATGGTTATGCC
T
AGTAGCATGTTCCTCCCTGCTGCCGCTGCGGACCGAGATGGGAACTCCACTTTGGAAGAGGCAGGAAAG
CAA
CCTGAAGCGTCAGAGGACCCGGGAAAGAACATCTTGCCACCTGCAAGCATGGAGCACGGCGGGGACC
TC
AAGCCGACCTCTGCTGACCCCAGCTGCGGGAGAGAAGACTCAGGCTTCCTCTGCTGGAAGAAGGGGTG
C
AACCAGGTCTTCAAAACCTCCGCCACACTGCAGACCCATTTCAACGAGGTGCACGCCAAGAGGCCCCAG
CTG
CCCGTGTCAGACCGCCACGTGTATAAGTACCGCTGCAACCAGTGCAGCCTGGCTTTCAAGACCATTG
AA
AAGCTGCAGCTCCACTCTCAGTACCACGTGATCAGAGCCGCCACCATGTGCTGCCTCTGTCAGCGCAG
T
TTCCGGACTTTCCAGGCTCTGAAAAAACACCTCGAGACGAGTCACCTGGAGTTGAGTGAGGCTGACATC
CAA
CAGCTTTATGGGGGGCTTCTGGCCAACGGGGACCTCTTGGCGATGGGAGACCCCACCCTGGCTGAAG
AC
CACACCATCATCGTTGAGGAAGACAAGGAGGAAGAGAGTGACCTGGAAGATAAGCAGAGCCCGACAGG
C
AGCGACTCTGGGTCAGTGCAGGAGGATTCAGGCTCCGAGCCAAAGCGAGCTCTGCCTTTCAGGAAAGGC
CCC
AACTTCACTATGGAGAAGTTTCTGGACCCTTCCCGCCCTTACAAGTGTACGGTCTGCAAGGAATCCT
TC
ACTCAAAAGAATATCCTGCTGGTGCACTACAACTCCGTCTCGCACCTGCACAAGTTAAAGAGGGCCCT
T
CAGGAATCGGCAACCGGCCAGCCGGAGCCCACCAGCAGCCCGGACAATAAGCCGTTTAAGTGTAACACT
TGC
AACGTGGCGTACAGCCAGAGTTCCACGCTGGAGATCCACATGCGGTCTGTGCTGCACCAGACCAAGG
CA
CGGGCAGCCAAGCTGGAGGCTGCAAGTGGGAACAGCAACGGGACTGGCAACAGCGGCGGGGTGTCCCT
C
AGCTCCTCTACCCCCAGTCCCGTGGGCAGCAGCGGCGCCAACAACACCTTTACCGCCACCAATCCAAGC
AGT
GCCGCCATGGCTCCAAGCGTCAATGCGCTGAGCCAGGTGCCACCCGAGAGCGTGGTGATGCCGCCTC
TG
GGGAACCCCATCAGTGCCAACATCGCTTCCCCTTCAGAGCCCAAAGAGGCCAACCGGAAGAAGTTAGC
G
GATATGATTGCGTCCAGGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAAGCCCAGACACTC
GCC
CAGGCCCAGGCGCAAGTCCAGGCACACCTGCAGCAGGAGCTGCAGCAACAGGCCGCCCTGATCCAGT
CT
CAGCTGTTCAACCCCACGCTCCTCCCACACTTCCCCATGACCACAGAGACCTTGCTCCAGCTGCAGCA
G
CAGCAGCACCTCCTCTTCCCCTTTTACATCCCCAGCGCTGAGTTCCAGCTCAACCCTGAGGTGAGCCTG
CCT
GTGACCAGCGGGGCACTGACACTCACGGGGTCAGGCCCAGGCCTGCTGGAAGATCTGAAGGCTCAGG
TC
CAGATCCCACAGCAGAGCCACCAGCAGATCCTGCAGCAGCAGCAGCAGCAGAGTCAGCTCTCTCTTTC
C
CAGAGTCATTCAGCCCTCCTGCAGCCAAGCCAACACCCGGAAAAGAAAAACAAAGTGGTCATCAAGGAA
AAG
GATAAGGAAAGCCAGAGAGAGAGGGAGGGGCCGGAGGGGGCAGAGGGTAACACGGGACCAAAGGAAT
CA
CTGCCAGATGCCTCGAAGGCCAAAGAGAAGAAAGACTTGGCACCAGGGGGCGGCTCTGAGGGCACTAT
G
CTTCCTCCACGCATTGCTTCAGATGCCAGGGGGAATGCTACCAAGGCCTTGCTGGAGAACTTTGGCTTT
GAG
CTCGTCATTCAGTATAATGAGAACAAGCAGAAGGCACAGAAGAAGAACGGGAAGGCGGAGCAAGGCG
GT
GAAAGCCTGGAGAAGCTGGAGTGTGACTCCTGCGGCAAGCTCTTCTCCAACATCTTGATTCTGAAGAG
C
CACCAGGAGCACGTGCATCAGAACTACTTCCCCTTCAAACAGCTGGAGAGGTTTGCCAAGCAATACAGA
GAG
CACTATGATAAACTGTACCCCCTGAGGCCCCAGACCCCGGAGCCACCCCCACCCCCTCCTCCGCCTC
CC
CCGCCTCCGCTTCCTACCGCACCTCCCCAGCCAGCTTCCGCGCCAGCCATCCCCGCGTCGGCTCCACC
C
ATCACTTCGCCCACCATCGCCCCCGCCCAACCCTCCGTGCCTCTCACCCAGCTCTCCATGCCAATGGAG
CTG
CCCATCTTCTCGCCACTGATGATGCAGACAATGCCACTGCAGACTCTGCCAGCTCAGCTGCCCCCTC
AG
CTCGGCCCCGTGGAGCCGCTGCCTGCCGATCTGGCCCAGCTCTACCAACACCAGCTCAACCCCACCTT
G
CTCCAGCAACAGAACAAGAGGCCTCGCACCAGGATCACGGATGACCAGCTCCGAGTGCTCAGGCAGTAC
TTC
GACATTAACAACTCCCCCAGTGAGGAGCAGATCAAAGAGATGGCGGACAAGTCGGGCCTGCCCCAGA
AA
GTGATCAAGCACTGGTTCAGAAACACTCTATTCAAGGAGCGGCAACGGAACAAGGACTCCCCGTACAA
C
TTCAGCAACCCTCCCATCACCAGTCTGGAGGAACTCAAGATCGACTCCCGGCCCCCTTCCCCCGAACCC
CAG
AAGCAGGAGTACTGGGGGAGCAAGCGGTCCTCGAGAACAAGGTTTACCGACTACCAGCTCCGAGTCC
TG
CAAGACTTCTTTGATGCCAATGCTTACCCAAAGGATGATGAATTTGAGCAGCTTTCTAACTTACTGAA
C
CTTCCAACCCGTGTCATAGTGGTGTGGTTTCAGAACGCCCGACAGAAAGCCAGGAAGAATTACGAGAAT
CAG
GGGGAGGGCAAAGACGGAGAGCGGCGCGAGCTTACCAACGATCGCTACATTCGGACGAGCAACTTGA
AT
TACCAGTGCAAAAAGTGCAGCCTCGTGTTTCAGCGCATCTTTGACCTCATCAAACACCAGAAGAAGCT
G
TGCTACAAGGATGAGGATGAGGAGGGGCAGGATGACAGCCAAAACGAGGACTCCATGGATGCCATGGAG
ATC
CTCACCCCTACCAGCTCCTCCTGCAGCACCCCTATGCCCTCGCAGGCTTACAGCACCCCGGCACCGT
CG
GCGGCAGCGGCCAATACCGCGCCCTCCGCGTTCTTGCAGCTCACAGCGGAGACTGATGAACTGGCCAC
C
TTCAACTCGAAAGCAGAGGCAAGCGATGAGAAGCCAAAGCAGGCCGACCCTCCCAGTGCACAGCCAAAC
CAA
ACCCAAGAGAAGCAAGGACAGCCAAAGCCAGAGATGCAGCAGCAGCTGGAGCAGCTGGAGCAGAAGA
CA
AACGCACCCCAGCCCAAGCTCCCGCAGCCGGCTGCCCCTTCCTTACCGCAGCCTCCTCCGCAGGCACC
C
CCTCCGCAGTGCCCCCTCCCCCAGTCAAGCCCCAGTCCCTCGCAGCTCTCCCATCTGCCCCTCAAGCCC
CTC
CACACGTCGACCCCTCAACAGCTGGCAAACCTACCTCCTCAGCTAATCCCCTACCAGTGTGACCAGT
GC
AAGCTGGCGTTCCCATCCTTCGAGCACTGGCAGGAGCACCAGCAGCTTCACTTCCTGAGTGCCCAGAA
C
CAGTTCATTCACCCCCAGTTTTTGGACAGGTCGTTGGACATGCCTTTCATGCTGTTTGATCCCAGTAAC
CCA
CTCCTGGCCAGCCAGCTGCTCTCGGGTGCCATCCCTCAGATCCCAGCGAGCTCAGCCACTTCCCCTT
CG
ACGCCCACCTCCACGATGAACACGCTCAAGAGGAAGCTGGAGGAAAAGGCCAGTGCGAGCCCCGGTGA
G
AACGACAGCGGCACGGGAGGAGAAGAGCCTCAGAGAGACAAGCGTTTGAGGACGACCATAACCCCGGAG
CAG
CTGGAAATTCTCTACCAGAAGTATCTGCTGGACTCCAACCCGACCCGAAAGATGCTGGATCACATCG
CG
CATGAGGTGGGCTTGAAGAAGCGCGTGGTACAGGTCTGGTTTCAGAACACCCGCGCCCGGGAAAGGAA
A
GGTCAGTTCCGGGCTGTGGGCCCGGCGCAGGCCCACAGGAGGTGCCCCTTTTGCCGAGCTCTCTTCAAG
GCC
AAGACAGCCCTGGAGGCTCATATCCGGTCTCGACACTGGCACGAAGCCAAGAGAGCCGGCTACAACC
TG
ACTCTGTCTGCCATGCTCTTAGACTGTGATGGGGGACTCCAAATGAAGGGAGACATTTTTGATGGAAC
T
AGCTTTTCCCACCTACCCCCGAGCAGTAGTGACGGTCAGGGTGTGCCCCTCTCGCCCGTGAGCAAAACC
ATG
GAGCTGTCCCCCAGAACTCTTCTCAGCCCTTCCTCCATCAAGGTGGAAGGGATCGAAGACTTTGAAA
GC
CCCTCCATGTCCTCCGTTAACCTGAACTTTGACCAAACTAAGCTGGACAATGATGACTGTTCCTCGGT
C
AACACCGCAATCACAGACACCACGACAGGGGACGAGGGCAACGCCGACAACGACAGCGCAACAGGAATA
GCG
ACTGAAACCAAATCTTCGGCACCGAACGAGGGGTTGACCAAAGCAGCCATGATGGCAATGTCCGAGT
AT
GAAGACCGGTTGTCATCTGGTCTGGTCAGCCCAGCCCCGAGCTTTTATAGCAAGGAATATGACAACGA
A
GGTACAGTGGACTACAGTGAAACCTCAAGCCTCGCGGACCCCTGCTCCCCAAGCCCCGGGGCAAGCGGG
TCC
GCTGGCAAATCTGGTGACGGCGGGGATCGACCTGGGCAGAAACGTTTTCGCACTCAAATGACCAATC
TG
CAGCTGAAGGTCCTCAAGTCATGCTTTAATGACTACAGGACACCCACCATGCTGGAGTGTGAGGTTCT
A
GGCAATGACATTGGATTGCCAAAGAGAGTTGTTCAGGTCTGGTTCCAGAATGCCCGGGCGAAAGAGAAG
AAG
TCCAAGTTAAGCATGGCCAAGCATTTTGGGATAAACCAAACGAGTTATGAGGGACCCAAGACCGAGT
GC
ACTTTGTGTGGCATCAAGTACAGCGCGAGGCTGTCTGTACGTGACCATATCTTTTCTCAACAGCATAT
C
TCCAAAGTTAAGGACACCATTGGAAGCCAGCTGGACAAGGAGAAAGAATATTTTGACCCAGCCACTGTA
CGC
CAGTTGATGGCTCAGCAAGAGCTGGACCGGATCAAGAAGGCTAACGAGGTCCTCGGACTGGCAGCTC
AA
CAACAAGGGATGTTCGACAACGCCCCTCTTCAGGCTCTTAACCTTCCTACCACGTATCCAGCGCTCCA
G
GGCATCCCTCCTGTGTTGCTCCCCGGCCTCAACAGCCCCTCTCTGCCAGGCTTTACCCCAGCCAACACA
G
CT
TTAACGTCTCCTAAACCGAACCTGATGGGTCTGCCCAGCACAACGGTACCTTCCCCCGGCCTCCCCA
CA
TCTGGATTACCAAATAAACCGTCCTCAGCCTCGCTGAGTTCCCCGACCCCAGCACAAGCCACCATGGC
A
ATGGCCCCTCAGCCACCCCCACAACCCCAGCAGCCGCAGCCACCGGTGCAGCAGCCTCCGCCGCCGCCA
GCA
GCCCAACAGATCCCTGCACCACAGCTGACCCCGCAGCAGCAACGTAAGGACAAAGATGGTGAGAAAG
GA
AAGGAGAAGGAAAAGGCACACAAAGGGAAGGGGGAGCCCCTCCCCGTCCCCAAGAAGGAGAAAGGAGA
G
GCCCCTCCAGCGGCTACAGCAACCATCTCAGCCCCACTGCCCGCCATGGAGTACGCAGTGGACCCTGCT
CAG
CTTCAGGCCCTACAGGCGGCCTTGACTTCAGACCCCACAGCTTTGCTCACGAGCCAGTTCCTTCCTT
AC
TTTGTACCGGGCTTTTCTCCTTATTATGCCCCCCAGATCCCTGGCGCCCTGCAGAGTGGGTACCTGCA
G
CCCATGTATGGCATGGAAGGCCTGTTTCCCTACAGCCCTGCCCTATCGCAGGCCCTGATGGGCTTGTCT
CCA
GGCTCCCTACTGCAGCAGTACCAGCAATACCAGCAGAGTCTGCAGGAGGCGATTCAGCAGCAGCAGC
AG
CAGCAGCAACAGCAACAGCAGCAGCAACAGCGGCAACTACAGCAACAGCAGCAGCAACAGCAACAAAA
A
GTACAGCAGCAGCAGCAGCAGCAGCAGCAGCCCAAAGCAAGCCAAACCCCAGTCCCCCAGGGGCCTGCT
TCC
CCAGACAAAGACCCTGCCAAAGAATCCCCCAAACCAGAAGAGCAGAAAAACGTCCCCCGTGAGGTGT
CC
CCCCTCCTGCCGAAACCCCCCGAAGAGCCAGAAGCAGAAAGCAAAAGTGCAAGTGCGGACTCCCTCTG
T
GACCCCTTCATTGTTCCAAAGGTGCAGTACAAGTTGGTCTGCCGCAAGTGCCAGGCGGGCTTCGGCGAC
GAG
GAGGCGGCGAGGAGCCACCTGAAGTCCCTCTGCTGCTTCGGCCAGTCTGTGGTGAACCTGCAAGAGA
TG
GTGCTTCATGTCCCCACCGGCAGCGGTGGCAGCGGCGGTGGCGGTGGTGGCAGCGGTGGCGGAGGCGG
C
TCGTACCACTGCCTGGCGTGCGAGAGCGCGCTCTGCGGGGAGGAAGCGCTGAGTCAGCATCTCGAGTCG
GCC
TTGCACAAACACAGAACAATCACGAGAGCAGCAAGAAACGCCAAAGAGCACCCTAGTTTATTACCTC
AC
TCTGCCTGCTTCCCCGATCCTAGCACCGCATCTACCTCGCAGTCTGCCGCTCACTCAAACGACAGCCC
C
CCTCCCCCGTCGGCCGCCCCGTCCTCGTCCGCTTCCCCCCACGCCTCCAGGAAGTCTTGGCCGCCAGTG
GGC
TCCCGGGCTTCGGCCGCGAAGCCCCCTTCTTTTCCTCCTCTCTCCTCATCTTCAACGGTTACCTCAA
GT
TCATGCAGCACCTCAGGGGTTCAGCCCTCGATGCCAACAGACGACTATTCGGAGGAGTCTGACACGGA
T
CTCAGCCAAAAGTCCGACGGACCGGCGAGCCCGGTGGAGGGTCCCAAAGACCCCAGCTGCCCCAAGGAC
AGT
GGTCTGACCAGTGTAGGAACGGACACCTTCAGATTGTAA


Translation (3723 aa):
MEGCDSPVVSGKDNGCGIPQHRQWTELNSAHLPDKPSSMEQPTGESHGPLDSLRAPFNERLADSSTSAGP
P
AEPASKEVSCNECSASFSSLQTYMEHHCPGTHPPPALREESASDTSEEGEEESDVENLAGEIVYQPDGS
A
YIVESLSQLAQSGAACGSSSGSGAVPSLFLNSLPGVGGKQGDPSCAAPVYPQIINTFHIASSFGKWFEG
S
DPAFPNTSALAGLSPVLHSFRVFDVRHKSNKDYLNSDGSAKSSCVSKDVPNNVDLSKFDGFVLYGKRKP
I
LMCFLCKLSFGYVRSFVTHAVHDHRMTLSEEERKLLSNKNISAIIQGIGKDKEPLVSFLEPKNKNFQHP
L
VSTANLIGPGHSFYGKFSGIRMEGEEALPAVAAAGPEQPQAGLLTPSTLLNLGGLTSSVLKTPITSVPL
G
PLASSPTKSSEGKDSGAAEGDKQESGGHQDCFSEKVEPAEEEEAEEEEEEEEEAEEEEEEEEEEEEEEE
E
GCKGLFPNDLEEELEDRPSEESGAPAGGSSKKDLALSNQSISNSPLMPNVLQTLSRGPASTTSNSASNF
V
VFDGANRRSRLSFNSEGVRANVAEGRRLDFADESANKDSATAPEPNESTEGDDGGFVPHHQHAGSLCEL
G
VGECPSGSGVECPKCDTVLGSSRSLGGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLEAHMKEKHPEPGG
S
CVYCKSGQPHPRLARGESYTCGYKPFRCEVCNYSTTTKGNLSIHMQSDKHLNNMQNLQNGGGEQVFSHS
A
GAAAAAAAAAAAAANIGSSCGAPSPTKPKTKPTWRCEVCDYETNVARNLRIHMTSEKHMHNMMLLQQNM
T
QIQHNRHLGLGSLPSPAEAELYQYYLAQNMNLPNLKMDSTASDAQFMMSGFQLDPTGPMAAMTPAL
VGG
E
IPLDMRLGGGQLVSEELMNLGESFIQTNDPSLKLFQCAVCNKFTTDNLDMLGLHMNVERSLSEDEWKAV
M
GDSYQCKLCRYNTQLKANFQLHCKTDKHVQKYQLVAHIKEGGKANEWRLKCVAIGNPVHLKCNACDYYT
N
SLEKLRLHTVNSRHEASLKLYK
HLQQHESGVEGESCYYHCVLCNYSTKAKLNLIQHVRSMKHQRSESLR
K
LQRLQKGLPEEDEDLGQIFTIRRCPSTDP
EEAVEDAEGPSEASADPEELAKDQGSGSEEGQSKRAASSS
Q
AEKELTDSPATTKRTSFPGSSETPLSSKRPKASEEIKPEQ
MYQCPYCKYSNADVNRLRVHAMTQHSVQP
L
LRCPLCQDMLNNKIHLQLHLTHLHSVAPDCVEKLIMT
VTAPEMVMPSSMFLPAAAADRDGNSTLEEAGK
Q
P
EASEDPGKNILPPASMEHGGDLKPTSADPSCGREDSGFLCWKKGCNQVFKTSATLQTHFNEVHAKRPQ
L
PVSDRHVYKYRCNQCSLAFKTIEKLQLHSQYHVIRAATMCCLCQRSFRTFQALKKHLETSHLELSEADI
Q
QLYGGLLANGDLLAMGDPTLAEDHTIIVEEDKEEESDLEDKQSPTGSDSGSVQEDSGSEPKRALPFRKG
P
NFTMEKFLDPSRPYKCTVCKESFTQKNILLVHYNSVSHLHKLKRALQESATGQPEPTSSPDNKPFKCNT
C
NVAYSQSSTLEIHMRSVLHQTKARAAKLEAASGNSNGTGNSGGVSLSSSTPSPVGSSGANNTFTATNPS
S
AAMAPSVNALSQVPPESVVMPPLGNPISANIASPSEPKEANRKKLADMIASRQQQQQQQQQQQQQAQTL
A
QAQAQVQAHLQQELQQQAALIQSQLFNPTLLPHFPMTTETLLQLQQQQHLLFPFYIPSAEFQLNPEVSL
P
VTSGALTLTGSGPGLLEDLKAQVQIPQQSHQQILQQQQQQSQLSLSQSHSALLQPSQHPEKKNKVVIKE
K
DKESQREREGPEGAEGNTGPKESLPDASKAKEKKDLAPGGGSEGTMLPPRIASDARGNATKALLENFGF
E
LVIQYNENKQKAQKKNGKAEQGGESLEKLECDSCGKLFSNILILKSHQEHVHQNYFPFKQLERFAKQYR
E
HYDKLYPLRPQTPEPPPPPPPPPPPPLPTAPPQPASAPAIPASAPPITSPTIAPAQPSVPLTQLSMPME
L
PIFSPLMMQTMPLQTLPAQLPPQLGPVEPLPADLAQLYQHQLNPTLLQQQNKRPRTRITDDQLRVLRQY
F
DINNSPSEEQIKEMADKSGLPQKVIKHWFRNTLFKERQRNKDSPYNFSNPPITSLEELKIDSRPPSPEP
Q
KQEYWGSKRSSRTRFTDYQLRVLQDFFDANAYPKDDEFEQLSNLLNLPTRVIVVWFQNARQKARKNYEN
Q
GEGKDGERRELTNDRYIRTSNLNYQCKKCSLVFQRIFDLIKHQKKLCYKDEDEEGQDDSQNEDSMDAME
I
LTPTSSSCSTPMPSQAYSTPAPSAAAANTAPSAFLQLTAETDELATFNSKAEASDEKPKQADPPSAQPN
Q
TQEKQGQPKPEMQQQLEQLEQKTNAPQPKLPQPAAPSLPQPPPQAPPPQCPLPQSSPSPSQLSHLPLKP
L
HTSTPQQLANLPPQLIPYQCDQCKLAFPSFEHWQEHQQLHFLSAQNQFIHPQFLDRSLDMPFMLFDPSN
P
LLASQLLSGAIPQIPASSATSPSTPTSTMNTLKRKLEEKASASPGENDSGTGGEEPQRDKRLRTTITPE
Q
LEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERKGQFRAVGPAQAHRRCPFCRALFK
A
KTALEAHIRSRHWHEAKRAGYNLTLSAMLLDCDGGLQMKGDIFDGTSFSHLPPSSSDGQGVPLSPVSKT
M
ELSPRTLLSPSSIKVEGIEDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGI
A
TETKSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEGTVDYSETSSLADPCSPSPGASG
S
AGKSGDGGDRPGQKRFRTQMTNLQLKVLKSCFNDYRTPTMLECEVLGNDIGLPKRVVQVWFQNARAKEK
K
SKLSMAKHFGINQTSYEGPKTECTLCGIKYSARLSVRDHIFSQQHISKVKDTIGSQLDKEKEYFDPATV
R
QLMAQQELDRIKKANEVLGLAAQQQGMFDNAPLQALNLPTTYPALQGIPPVLLPGLNSPSLPGFTPANT

A
LTSPKPNLMGLPSTTVPSPGLPTSGLPNKPSSASLSSPTPAQATMAMAPQPPPQPQQPQPPVQQPPPPP
A
AQQIPAPQLTPQQQRKDKDGEKGKEKEKAHKGKGEPLPVPKKEKGEAPPAATATISAPLPAMEYAVDPA
Q
LQALQAALTSDPTALLTSQFLPYFVPGFSPYYAPQIPGALQSGYLQPMYGMEGLFPYSPALSQALMGLS
P
GSLLQQYQQYQQSLQEAIQQQQQQQQQQQQQQQRQLQQQQQQQQQKVQQQQQQQQQPKASQTPVPQGPA
S
PDKDPAKESPKPEEQKNVPREVSPLLPKPPEEPEAESKSASADSLCDPFIVPKVQYKLVCRKCQAGFGD
E
EAARSHLKSLCCFGQSVVNLQEMVLHVPTGSGGSGGGGGGSGGGGGSYHCLACESALCGEEALSQHLES
A
LHKHRTITRAARNAKEHPSLLPHSACFPDPSTASTSQSAAHSNDSPPPPSAAPSSSASPHASRKSWPPV
G
SRASAAKPPSFPPLSSSSTVTSSSCSTSGVQPSMPTDDYSEESDTDLSQKSDGPASPVEGPKDPSCPKD
S
GLTSVGTDTFRL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser