NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS22648.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22648.2 Public Mus musculus 8 Nfat5 23 108 98 CCDS HistoryNCBI Gene:54446Re-query CCDS DB by CCDS ID:22648.2Re-query CCDS DB by GeneID:54446See the combined annotation on chromosome 8 in Sequence Viewer

Public Note for CCDS 22648.1
The coding region has been updated to extend the N-terminus to one that is more supported by available conservation data or publications.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 22648.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000151114.7 ENSMUSP00000119370.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000151114.7Link to Ensembl Protein Viewer:ENSMUSP00000119370.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000151114Re-query CCDS DB by Protein ID:ENSMUSP00000119370
Original member Current member EBI ENSMUST00000169453.7 ENSMUSP00000127784.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169453.7Link to Ensembl Protein Viewer:ENSMUSP00000127784.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000169453Re-query CCDS DB by Protein ID:ENSMUSP00000127784
Original member Current member NCBI NM_018823.2 NP_061293.2 Accepted alive Link to Nucleotide Sequence:NM_018823.2Link to Protein Sequence:NP_061293.2Re-query CCDS DB by Nucleotide ID:NM_018823Re-query CCDS DB by Protein ID:NP_061293Link to BLAST:NP_061293.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_061293.2 1552 Q9WV30-2 1552 100% 0 0

Chromosomal Locations for CCDS 22648.2

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 107293826 107293898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107295581 107295634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107324639 107324764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107338809 107339367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107344786 107344978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107347667 107347857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107351427 107351599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107355515 107355649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107355770 107355822 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107358634 107358766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107361744 107361824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107366179 107366327 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107367049 107369551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107370418 107370653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4659 nt):
ATGCCCTCGGACTTCATCTCATTGCTCAGCGCGGACCTAGACCTGGAATCGCCCAAGTCCCTGTACTCGC
GA
GATTCTCTGAAGTTACACCCATCACAGACTTTTCATAGAGCTGGACTATTGGAAGAATCTGTCTATGA
T
CTTCTCCCAAAGGAGTTACAGTTACCTCCACCTAGAGAAACATCTGTAGCATCAATGAGTCAGACAAGC
GGT
GGTGAGGCAGGCTCGCCTCCTCCAGCTGTAGTTGCTGCTGATGCTTCTTCAGCTCCCTCCTCTTCCT
CC
ATGGGCGGTGCTTGCAGCTCCTTTACCACCTCTTCCAGCCCTACCATTTATTCTACCTCAGTCACCGA
C
AGCAAGGCTATGCAAGTGGAGAGCTGCTCCTCAGCCGTGGGGGTAAGTAACAGAGGGGTAAGTGAAAAG
CAG
TTAACCGGTAACACAGTTCAGCAGCATCCATCAACCCCGAAGAGGCACACAGTTTTGTACATCTCAC
CA
CCACCTGAGGACTTGCTGGATAACAGTCGGATGTCCTGCCAGGATGAGGGGTGTGGATTGGAATCTGA
G
CAGAGCTGCAGTATGTGGATGGAGGATTCCCCCTCCAACTTCAGTAACATGAGCACCAGTTCCTACAAT
GAT
AACACTGAGGTACCTCGTAAATCACGAAAACGAAATCCAAAGCAGAGGCCGGGGGTCAAACGACGAG
AT
TGTGAAGAATCTAATATGGATATATTTGATGCCGACAGTGCCAAAGCACCTCACTATGTGCTTTCTCA
G
CTTACCACGGACAACAAAGGCAACTCAAAAGCTGGAAATGGAACATTGGACAGCCAAAAGGGAACTGGA
GTA
AAGAAGAGCCCTATGTTGTGCGGACAGTATCCGGTTAAAAGTGAGGGGAAGGAGCTGAAGATAGTGG
TA
CAGCCTGAAACCCAACACCGAGCCCGGTACCTGACAGAGGGCAGCCGAGGCTCTGTAAAAGACAGAAC
A
CAGCAAGGCTTTCCTACGGTGAAGCTGGAAGGCCATAATGAACCAGTGGTGTTGCAGGTATTTGTGGGC
AAT
GATTCTGGTCGAGTAAAACCACATGGATTCTATCAGGCCTGTAGAGTAACTGGGCGAAATACAACTC
CC
TGCAAAGAAGTGGACATTGAAGGTACCACTGTTATAGAAGTTGGTCTTGATCCTAGCAACAACATGAC
A
CTGGCGGTGGACTGTGTTGGAATATTGAAGCTGAGGAATGCCGATGTTGAAGCCAGAATTGGAATTGCT
GGA
TCTAAGAAAAAGAGCACTCGTGCCAGATTGGTTTTTCGAGTTAATATCACAAGGAAAGATGGCTCTA
CT
CTGACATTGCAGACACCTTCTTCCCCCATTTTATGCACTCAGCCAGCAGGAGTTCCTGAGATCTTAAA
G
AAAAGCTTGCATAGCTGTTCAGTGAAAGGAGAGGAAGAAGTATTTTTAATTGGGAAAAACTTTCTGAAA
GGA
ACTAAAGTTATTTTCCAGGAAAATGTTTCTGATGAAAACTCTTGGAAATCAGAAGCTGAAATTGACA
TG
GAGTTATTCCATCAGAACCATCTTATTGTGAAGGTTCCTCCGTATCATGACCAACATATAACTTTGCC
T
GTATCAGTGGGAATATATGTTGTGACCAATGCTGGAAGATCTCATGATGTTCAGCCATTTACGTACACT
CCG
GATCCAGCAGCTGGTGCTTTGAATGTAAATGTGAAAAAGGAGATATCTAGTCCAGCAAGACCTTGCT
CT
TTTGAAGAAGCCATGAAAGCAATGAAAACGACTGGATGTAACGTAGATAAGGTGACTATCCTTCCTAA
T
GCCCTGATCACTCCACTCATATCAAGCAGTATGATTAAGACTGAAGATGTTACTCCAATGGAAGTAACT
TCA
GAAAAAAGATCTTCCCCAATTTTTCAGACTACAAAGAGCATTGGATCAACCCAGCAAACCTTAGAAA
CT
ATTTCTAACATAGCGGGGGGTGCACCCTTCTCCTCACCGTCGTCATCTTCCCACTTAACTCCTGAAAG
T
GAGAATCAGCAGCAGCTTCAGCCCAAGGCATACAACCCAGAGACCCTGACAACTATCCAGACACAGGAC
ATC
TCACAGCCCGGGACCTTTCCCGCAGTTTCTGCTGCTAGTCAGCTGCCCAGCAGCGATGCACTACTGC
AG
CAGGCAACACAGTTTCAGACAAGAGAAGCTCAGTCCAGAGACACAATACAGTCAGATACAGTGGTTAA
C
TTGTCACAGTTAACTGAAGCATCACAGCAGCAGCAATCCCCACTACAAGAACAAGCACAAACGTTACAG
CAG
CAGATACCATCAAATATTTTTCCATCGCCAAGCAGTGTCAGCCAGCTCCAGAGTACTATTCAGCAGC
TG
CAAGCAGGAAGTTTCACAGGCAGCGCTGCTGGCGGCAGGAGTGGAAGCGTTGATTTGGTCCAGCAGGT
T
TTAGAGGCACAACAGCAGTTATCGTCTGTTCTGTTTTCTACTCCAGATGGGAATGAGAATGTTCAAGAA
CAG
CTTAATGCAGACATTTTCCAAGTCAGTCAAATTCAAAATAGTGTAAGCCCTGGAATGTTTTCTTCAG
CG
GAGTCTGCAGTTCACACTAGACCAGATAACTTACTACCTGGGAGGGCTGACAGCGTCCATCAACAGAC
T
GAAAATACACTGTCTAATCAGCAGCAGCAGCAACAGCAGCAGCAGCAAGTGATGGAGTCATCAGCTGCA
ATG
GTGATGGAGATGCAGCAGAGCATTTGCCAAGCAGCTGCCCAGATCCAGTCAGAGCTGTTTCCTTCAG
CT
GCTTCAGCAAGTGGAAGCCTTCAGCAGTCTCCAGTTTACCAGCAGCCTTCTCACATGATGAGTGCACT
G
CCTACCAACGAGGACATGCAGATGCAGTGTGAGCTGTTCTCGTCTCCCCCTGCAGCTTCTGGAAACGAA
ACT
TCCACAACCACCACGCCACAGGTGGCAACCCCTGGCTCCACCATGTTTCAGACACCAAGTTCAGGAG
AT
GGAGAAGAAACTGGAGCACAAGCAAAACAGATTCAGAACAGCGTCTTTCAGACAATGGTCCAAATGCA
G
CGCAGTGGTGACAGCCAACCTCAAGTAAACCTCTTTTCATCTACAAAAAATATAATGAGTGTTCAGAAT
AAT
GGTACCCAGCAACAAGGGAATAGCTTGTTCCAGCAAGGGAGCGAGATGATGTCACTTCAGTCTGGGA
AC
TTTTTGCAGCAGTCCTCTCATTCACAGGCTCAGCTCTTTCATCCTCAAAATCCTATTGCTGATGCTCA
G
AACCTTTCCCAGGAAACTCAAGGTTCAATTTTTCATAGTCCAAATCCTATTGTCCACAGTCAAACTTCC
ACA
GCATCCTCTGAACAACTGCAGCCTTCAATGTTTCACTCTCAGAATACCATTGCTGTGTTACAGGGCT
CT
TCAGTTCCTCAAGACCAGCAGTCACCCAACATATTTCTTTCCCAAAGTTCTATCAATAATCTTCAAAC
T
AACACAGTAGCCCAAGAAGAGCAGATTTCATTTTTTGCAGCACAGAACTCAATTTCTCCACTTCAGTCA
ACA
TCAAACACTGAGCAGCAAGCTGCTTTCCAACAGCAGCCTCCAATCTCACACATCCAGACCCCTATTC
TT
TCCCAGGAACAGGCACAACCCTCTCAGCAAGGGTTATTTCAGCCTCAGGTGGCCCTTGGCTCCCTGCC
T
CCTAATCCAATGCCTCAAAACCAGCAAGGTCCAATTTTCCAAACACAGCGCCCAATAGTTGGCATGCAG
AGT
AACTCTCCATCCCAGGAGCAGCAGCAGCAGCAACAGCAGCAACAGCAGCAGCAGCAACAGCAACAAC
AA
CAGCAACAGAGCATTTTATTCAGTAATCAGAATGCCATGGCTACAATGGCCTCCCAGAAGCAGCCACC
A
CCAAACATGATGTTTAGCCCAAACCAGAACCCAATGGCTAGTCAGGAGCAGCAGAACCAGTCAATTTTT
CAC
CAGCAAAGTAATATGGCCCCAATGAACCAAGAGCAGCAGCCCATGCAATTTCAGAATCAGCCTACGG
TT
TCCTCACTTCAGAACCCAGGTCCTACGCAGTCTGAGTCACCACAGACCTCCTTGTTCCATAGCTCTCC
T
CAGATCCAGTTGGTTCAAGGGTCACCTAGTTCTCAAGATCAGCAAGTAACACTCTTCCTCTCTCCAGCA
TCC
ATGTCTGCATTGCAAACCAGTATAAACCAACCAGACATGCAGCAGTCTCCTCTTTATTCCCCGCAGA
AC
AACATCCCTGGAATCCAAGGAAGCACTTCTTCACCCCAGCCACAGGCTACTTTATTTCACAACACTAC
A
GGAGGCACAATAAACCAAATACAAAATTCTCCTGGCTCATCTCAGCAGACTTCAGGAATGTTCTTATTT
GGC
ATTCAAAATAATTGTAGTCAGCTTTTAACCTCCGGACCAGCTACATTGCCAGATCAGCTGATGGCCA
TA
AATCAGCAGGGCCAACCACAAAATGAGGGCCAATCTTCTGTGACAACACTTCTTTCTCAGCAAATGCC
A
GAGACTTCCCCACTGGCCTCCTCTGTGAACAGCAGTCAGAACATGGAAAAGATTGATTTGCTTGTTTCA
TTG
CAAAGCCAAGGGAACAATTTAACCGGCTCCTTTTAG


Translation (1552 aa):
MPSDFISLLSADLDLESPKSLYSRDSLKLHPSQTFHRAGLLEESVYDLLPKELQLPPPRETSVASMSQTS
G
GEAGSPPPAVVAA
DASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEK
Q
LTGNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYN
D
NTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGN
GTLDSQKGTG
V
KKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVK
LEGHNEPVVLQVFVG
N
DSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTL
AVDCVGILKLRNADVEARIGIA
G
SKKKSTRARLVFRVNITRKDGSTLTLQTPSSPILC
TQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLK
G
TKVIFQENVS
DENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYT
P
DP
AAGALNVNVKKEISSPARPCSFEEAMKAMKTTGCNVDKVTILPNALITPLISSSMIKTEDVTPMEVT
S
EKRSSPIFQ
TTKSIGSTQQTLETISNIAGGAPFSSPSSSSHLTPESENQQQLQPKAYNPETLTTIQTQD
I
SQPGTFPAVSAASQLPSSDALLQQATQFQTREAQSRDTIQSDTVVNLSQLTEASQQQQSPLQEQAQTLQ
Q
QIPSNIFPSPSSVSQLQSTIQQLQAGSFTGSAAGGRSGSVDLVQQVLEAQQQLSSVLFSTPDGNENVQE
Q
LNADIFQVSQIQNSVSPGMFSSAESAVHTRPDNLLPGRADSVHQQTENTLSNQQQQQQQQQQVMESSAA
M
VMEMQQSICQAAAQIQSELFPSAASASGSLQQSPVYQQPSHMMSALPTNEDMQMQCELFSSPPAASGNE
T
STTTTPQVATPGSTMFQTPSSGDGEETGAQAKQIQNSVFQTMVQMQRSGDSQPQVNLFSSTKNIMSVQN
N
GTQQQGNSLFQQGSEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSIFHSPNPIVHSQTS
T
ASSEQLQPSMFHSQNTIAVLQGSSVPQDQQSPNIFLSQSSINNLQTNTVAQEEQISFFAAQNSISPLQS
T
SNTEQQAAFQQQPPISHIQTPILSQEQAQPSQQGLFQPQVALGSLPPNPMPQNQQGPIFQTQRPIVGMQ
S
NSPSQEQQQQQQQQQQQQQQQQQQQQSILFSNQNAMATMASQKQPPPNMMFSPNQNPMASQEQQNQSIF
H
QQSNMAPMNQEQQPMQFQNQPTVSSLQNPGPTQSESPQTSLFHSSPQIQLVQGSPSSQDQQVTLFLSPA
S
MSALQTSINQPDMQQSPLYSPQNNIPGIQGSTSSPQPQATLFHNTTGGTINQIQNSPGSSQQTSGMFLF
G
IQN
NCSQLLTSGPATLPDQLMAINQQGQPQNEGQSSVTTLLSQQMPETSPLASSVNSSQNMEKIDLLVS
L
QSQGNNLTGSF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser