NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS22623.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22623.1 Public Mus musculus 8 Slc12a4 23 108 98 CCDS HistoryNCBI Gene:20498Re-query CCDS DB by CCDS ID:22623.1Re-query CCDS DB by GeneID:20498See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22623.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000116429.8 ENSMUSP00000112130.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000116429.8Link to Ensembl Protein Viewer:ENSMUSP00000112130.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000116429Re-query CCDS DB by Protein ID:ENSMUSP00000112130
Original member Current member NCBI NM_009195.3 NP_033221.1 Accepted alive Link to Nucleotide Sequence:NM_009195.3Link to Protein Sequence:NP_033221.1Re-query CCDS DB by Nucleotide ID:NM_009195Re-query CCDS DB by Protein ID:NP_033221Link to BLAST:NP_033221.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033221.1 1085 Q9JIS8 1085 100% 0 0

Chromosomal Locations for CCDS 22623.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 105944082 105944173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105944275 105944408 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105944522 105944706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105945135 105945242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105945340 105945471 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105945561 105945730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105945845 105946040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105946691 105946859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105947057 105947161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105947493 105947612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105947853 105947951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105949138 105949256 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105949654 105949828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105950197 105950254 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105950505 105950603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105950696 105950860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105951422 105951636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105951780 105952021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105953808 105953938 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105955427 105955481 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105955581 105955727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105959358 105959489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105960676 105960770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105965925 105966039 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3258 nt):
ATGCCTCACTTCACCGTGGTGCCGGTGGACGGGCCGCGACGCGGCGACTATGACAACCTCGAGGGGCTCA
GT
TGGGTGGACTACGGCGAGCGCGCCGAGCGGGAAGACTCGGACGGACAGGGTAACCACAGAGAGAATAG
C
CCTTTCCTTTGCCCTTTGGACGCCTCCAGAGGAAATGACTACTATGACCGGAACTTGGCACTGTTTGAG
GAG
GAGCTGGACATCCGCCCAAAGGTGTCATCTCTCCTGGGCAAGCTTGTCAGCTATACCAACCTCACCC
AA
GGAGCCAAGGAGCACGAGGAGGCTGAGAGTGGAGAAGGTGGCCGACGGAGAGCTGCCAAGGCTCCCAG
C
ATGGGCACACTCATGGGAGTGTACCTGCCCTGCCTGCAGAATATCTTTGGGGTCATCCTCTTCCTGCGG
CTG
ACCTGGATGGTGGGCACAGCTGGTGTGCTGCAGGCTCTCCTCATTGTCCTCATCTGCTGCTGCTGTA
CC
CTGCTGACAGCCATCTCCATGAGCGCCATTGCCACCAACGGCGTGGTTCCAGCTGGTGGCTCGTACTT
C
ATGATTTCCCGCTCTTTGGGACCAGAATTCGGAGGTGCTGTGGGCCTGTGCTTCTACCTGGGGACGACA
TTT
GCAGCAGCCATGTATATCCTAGGGGCCATTGAGATCTTGCTGACCTACATTGCTCCGCCAGCTGCCA
TC
TTTTACCCATCGGGCACCCATGACATGTCAAGCGCCACCTTGAATAACATGAGAGTGTATGGGACCAT
T
TTCCTGACTCTGATGACCCTAGTGGTGTTTGTCGGTGTCAAGTACGTGAACAAGTTTGCCTCGCTCTTC
CTG
GCCTGCGTGATCATCTCCATCCTTTCCATTTACGCGGGAGGCATCAAGTCCATTTTTGACCCTCCCG
TG
TTTCCGGTGTGTATGCTGGGCAATAGGACCCTGTCTCGGGACCAGTTTGACATCTGTGCCAAGACAGT
C
GTGGTGGACAATGAGACAGTGGCCACCCGGCTGTGGACTTTCTTCTGCCACAGCCCCAACCTTACTGCT
GAC
TCCTGTGACCCCTACTTCCTGCTCAACAATGTGACAGAGATTCCTGGCATACCTGGGGCAGCTGCTG
GT
GTGCTCCAGGAGAACCTCTGGAGCGCTTACCTGGAGAAGGGGGAGGTCGTGGAGAAGCATGGGCTGCC
G
TCCACAGACACCCTCGGCCTAAAGGAGAGCCTGTCCCTGTATGTGGTGGCTGACATCGCCACGTCCTTC
ACC
GTGCTGGTTGGCATCTTTTTCCCTTCTGTGACAGGCATCATGGCTGGTTCAAACCGCTCCGGGGATC
TC
CGTGACGCCCAGAAGTCTATCCCAGTGGGGACCATTCTGGCCATTGTTACCACTTCGCTGGTGTACTT
C
AGCAGTGTGATCCTCTTCGGTGCCTGCATCGAGGGTGTGGTACTCCGGGACAAGTACGGTGATGGCGTC
AGC
AGGAACCTGGTGGTGGGCACCCTGGCCTGGCCTTCGCCTTGGGTCATCGTGGTTGGCTCCTTCTTCT
CA
ACATGTGGGGCTGGTCTCCAGAGCCTCACTGGGGCGCCACGTTTACTGCAAGCCATTGCCAAGGATAA
C
ATCATCCCCTTCCTCCGGGTGTTTGGCCATGGGAAAGCAAACGGTGAACCGACGTGGGCCCTCCTCCTG
ACA
GCGCTCATCGCTGAGCTGGGCATCCTGATTGCTTCCCTTGACATGGTGGCCCCCATTCTGTCCATGT
TC
TTTCTGATGTGTTACCTCTTTGTAAACTTGGCCTGTGCCGTGCAGACACTTCTGAGGACCCCCAACTG
G
CGGCCCCGGTTCAAGTACTATCACTGGACATTGTCTTTCCTAGGCATGAGTCTCTGCCTGGCTCTTATG
TTT
GTCTCCTCCTGGTACTATGCCCTAGTGGCCATGCTCATCGCAGGCATGATCTACAAGTACATCGAGT
AC
CAAGGGGCCGAGAAGGAGTGGGGCGATGGGATCCGAGGCCTGTCCCTGAGTGCGGCACGCTATGCACT
G
CTGAGGCTGGAGGAAGGGCCTCCTCACACCAAGAACTGGCGGCCTCAGCTCCTGGTGCTGCTTAAGTTA
GAC
GAAGATCTTCATGTGAAGTACCCCCGGCTCCTCACCTTCGCCTCCCAGCTGAAGGCCGGGAAGGGCC
TG
ACAATCGTTGGCTCTGTCATCCAGGGCAGCTTTCTGGAGAGCTATGGTGAAGCCCAGGCCGCTGAGCA
G
ACCATCAAGAACATGATGGACATTGAGAAAGTCAAAGGCTTCTGCCAGGTAGTGGTGGCCAGCAAGGTT
CGA
GAGGGACTGGCCCACCTCATCCAGTCTTGCGGCCTGGGCGGCATGAGACACAACTCCGTGGTGCTGG
GC
TGGCCCTATGGCTGGCGACAGAGTGAGGACCCACGTGCCTGGAAGACCTTTATTGACACTGTGCGCTG
C
ACCACAGCTGCCCACCTGGCCCTGCTGGTGCCAAAGAACATAGCTTTCTACCCCAGCAACCACGAGCGC
TAC
CTGGATGGCCATATCGACGTGTGGTGGATCGTGCATGATGGAGGCATGCTTATGCTGCTGCCCTTTC
TG
CTGCGCCAGCATAAGGTTTGGAAGAAGTGCCGGATGCGCATTTTCACCGTGGCCCAGATGGATGACAA
C
AGCATCCAGATGAAGAAGGATCTGGCCATCTTCCTGTATCACCTCCGCCTGGAAGCTGAAGTGGAGGTG
GTA
GAGATGCACAACAGTGACATCTCTGCCTATACCTATGAGCGGACACTGATGATGGAGCAGCGGTCTC
AG
ATGCTGCGGCAGATGAGGTTGACCAAAACTGAGCGGGATCGAGAGGCCCAGCTGGTAAAGGACAGGCA
C
TCGGCTCTTAGGCTGGAGAGCCTCTACTCCGACGAGGAGGAAGAGTCTGTGGCAGGGGCCGACAAGATC
CAG
ATGACGTGGACCAGAGACAAGTACATGGCTGAGCCCTGGGACCCCAGCCACGCCCCTGACAACTTCC
GG
GAGCTGGTGCACATTAAGCCGGACCAGTCCAACGTGCGGCGCATGCACACTGCTGTGAAGCTCAACGA
G
GTCATTGTCACGCGCTCCCACGATGCCCGTCTGGTTTTGCTGAACATGCCTGGCCCCCCTAAGAACAGC
GAG
GGCGACGAGAACTACATGGAATTCCTTGAAGTCCTAACCGAGGGCCTTGAACGGGTGTTGTTGGTGC
GT
GGCGGCGGCCGGGAAGTCATCACCATCTATTCCTGA


Translation (1085 aa):
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAEREDSDGQGNHRENSPFLCPLDASRGNDYYDRNLALFE
E
ELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAK
APSMGTLMGVYLPCLQNIFGVILFLR
L
TWMVGTAGVLQALLIVLICCCC
TLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTT
F
AAAMYILGAIEILL
TYIAPPAAIFYPSGTHDMSSATLNNMRVYGTIFLTLMTLVVFVGVKYVNKFASLF
L
ACVIISILSIYAGGIKSIFDPPVF
PVCMLGNRTLSRDQFDICAKTVVVDNETVATRLWTFFCHSPNLTA
D
SCDPYFLLNNVTEIPGIPGAAAGVLQ
ENLWSAYLEKGEVVEKHGLPSTDTLGLKESLSLYVVADIATSF
T
VLVGIFFPSVT
GIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGV
S
RNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLR
VFGHGKANGEPTWALLL
T
ALIAELGILIASLDMVAPILS
MFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLALM
F
VSSWYYALVAMLIAGMIYKYIEYQ
GAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKL
D
EDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLESYGEAQAAEQ
TIKNMMDIEKVKGFCQVVVASKV
R
EGLAHLIQSCGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFI
DTVRCTTAAHLALLVPKNIAFYPSNHER
Y
LDGHIDVWWIVHDGGMLMLLPFLLRQHK
VWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEV
V
EM
HNSDISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRHSALRLESLYSDEEEESVAGADKI
Q
MTWTRDKYMAEPWDPSHAPDNFRELVHIK
PDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNS
E
GDEN
YMEFLEVLTEGLERVLLVRGGGREVITIYS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser