NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 18, 2019, starting at 8:15 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22607.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22607.1 Reviewed, withdrawal pending Mus musculus 8 Carmil2 21 106 86 CCDS HistoryNCBI Gene:234695Re-query CCDS DB by CCDS ID:22607.1Re-query CCDS DB by GeneID:234695See the combined annotation on chromosome 8 in Sequence Viewer

Public Note for CCDS 22607.1
This coding region was withdrawn because currently there is insufficient support for the transcript and the protein.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by CCDS collaboration)

Sequence IDs included in CCDS 22607.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000062574 ENSMUSP00000052322 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000062574Link to Ensembl Protein Viewer:ENSMUSP00000052322Re-query CCDS DB by Nucleotide ID:ENSMUST00000062574Re-query CCDS DB by Protein ID:ENSMUSP00000052322
Original member Current member EBI,WTSI OTTMUST00000151489 OTTMUSP00000078559 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000151489Link to Vega Protein Viewer:OTTMUSP00000078559Re-query CCDS DB by Nucleotide ID:OTTMUST00000151489Re-query CCDS DB by Protein ID:OTTMUSP00000078559
Original member NCBI NM_001033320.2 NP_001028492.1 Removed not alive Link to Nucleotide Sequence:NM_001033320.2Link to Protein Sequence:NP_001028492.1Re-query CCDS DB by Nucleotide ID:NM_001033320Re-query CCDS DB by Protein ID:NP_001028492Link to BLAST:NP_001028492.1

Chromosomal Locations for CCDS 22607.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 105691171 105691245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105691327 105691425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105692301 105692429 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105692517 105692630 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105692803 105692963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105693038 105693125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105693256 105693396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105693525 105693591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105694014 105694249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105695025 105695125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105695208 105695568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105695652 105695774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105696861 105696897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105697024 105697095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105697217 105697438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105697868 105697945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 105698031 105698143 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2217 nt):
ATGCCGCTGCCACTGAATGACGTAACCCAGGCTCATCGCAGCCGGCCAGAACTCACAACTCGAGCGGTCC
AT
CAGATCCAAGCCTGTCTCTGGAGGAACAACCAAGTAGACTCTACTTCGGACCTCAAGCCCTGCCTTCA
G
CCCTTAGGTCTGATTTCAGACCACTCAGAGCAGGAGGTGAACGAGCTATGCCAGTCAGTACAGGAGCAT
ATG
GAGCTGCTGGGCTGTGGGGCTGGGCCCCAGGGTGAGGTTGCCGTGCACCAGGCTGAGGACGCCATCC
AG
AATGCCAACTTCTCTCTCAGTATCCTCCCCATTCTCTATGAGGCTGGGAGATCCCCAAGCCACCACTG
G
CAGCTGCAGCAGAAGCTAGAGAGCCTCCTGGGTCAGGTGGGCGAGATCTGCCGCCAGGACATCCAGGAC
TTC
ACTCAGACCACCCTGGATACCACAAGGAGCCTCTGCCCACAGATGTTGCAGACACCTGGCTGGAGGA
AG
CAGCTAGAGGGAGTTCTGGTGGGCTCCGGGGGCCTCCCAGAGCTGCTTCCGGAACATCTGCTGCAAGA
T
GCCTTCTCTAGGCTGAGGGACATGCGCCTGTCAATCACTGGGACCCTAGCAGAGAGCATTGTGGCTCAG
GCT
CTTGCAGGTCTTCATGCAGCCCGAGATCGACTGGTGGAGAGGCTAACTCAGCAGGCACCAGTGACCA
TG
GCCCCTGCTGTACCACCACTGGGTGGAAATGAGCTCAGCCCCCTTGAGACTGGGGGATTGGAAGAGCT
T
TTCTTTCCCACGGAGAAGGAAGAGGAGAGAGAAAAGGATGAGAGTTCTTCATGGAAATGGCTTGAGCCT
AGT
AACTGTTTTCACCTGGTCTCCTCCCTTCATGGTGCTGCTGAGGAAGCGGAACGGGACCCCGAGCTGG
CA
GCTCCGGGGGAAGATGCAGAGCCGCAGGCTGGGCCGTCTGCACGCGGCTCTCCAAGCCCCGCCGCCCC
G
GGGCCACCCGCCGGCCCTCTGCCTCGCATGGACCTGCCACCCGCCGGGCAACCCCTACGCCACCCAACC
CGA
GCCCGACCGAGACCACGTCGCCAGCACCACCACCGCCCGCCGCCGGGGGGCCCCCAGGTGCCCCCAG
CC
CTGCTTCAAGAAGGAAATGGGCTCACTGCTCGCGTGGATGAGGGTGTGGAGGAGTTCTTCTCCAAAAG
G
CTGATCCAGCAGGATCACTTCTGGGCCCCAGAGGAGGATCCAGCCACTGAGGGTGGTGCCACTCCTGTC
CCC
CGCACACTTCGAAAGAAGCTGGGTACGCTCTTTGCCTTTAAGAAACCTCGTTCAACAAGGGGTCCGC
GA
CCTGACCTGGAGACCAGCCCTGGAGCAGCAGCTCGAGCCAGAAAATCCACACTTGGGGATCTCCTGCG
A
CCACCGGCCCGTCCAGGCCGTGGTGAGGAACCTGGAGGGGCGGAAGGCGGCACCAGCAGCCCTGACCCT
GCT
CGCAGAAATCGGCCTCGGTACACGCGGGAAAGCAAGGCCTACTCCATGATCCTGCTACCTGCTGAGG
AG
GAAGCAGCCGTGGGTACCAGACCTGATAAGAGGCGGCCTCTGGAACGGGGAGACACAGAACTGGCTCC
A
TCTTTTGAGCAGCGGGTACAAGTGATGCTACAGAGGATCGGCGTGAGCCGGGCCAGTGGGGGTGCCGAG
AGC
AAGAGGAAGCAAAGTAAAGACGGCGAGATCAAGAAGGCAGGCTCTGATGGTGACATTATGGACAGTT
CC
ACAGAGACCCCTCCCATCTCAATCAAGTCCCGTACCCACTCTGTGTCTGCTGATCCCTCATGCAGACC
T
GGGCCAGGAGGCCAGGGGCCTGAGTCTGCCACCTGGAAGACATTGGGACAGCAGCTGAATGCAGAGCTC
AGA
GGCCGTGGTTGGGGCCAACAGGATGGTCCAGGGCCCCCCTCCCCATGTCCCAGCCCAAGTCCCCGAA
GA
ACCAGCCCCGCCCCAGACATCCTGAGTCTCCCAGAGGACCCCTGCTTGGGCCCTAGGAATGAAGAACG
G
CCCCTCCGGCTGCAGCGCTCCCCTGTCCTCAAGCGTAGGCCGAAGCTCGAGGCACCCCCATCCCCAAGC
TTA
GGCTCTGGCCTTGGATCCAAGCCTCTTCCTCCGTACCCCACAGAACCCTCCAGCCCTGAGCGGAGCC
CT
CCCTCCCCAGCCACAGACCAAAGAGGCGGCGGCCCCAACCCCTGA


Translation (738 aa):
MPLPLNDVTQAHRSRPELTTRAVHQIQACLWRNNQVDSTSDLKPCLQPLGLISDHSEQEVNELCQSVQEH
M
ELLGCGAGPQGEVAVHQAEDAIQNANFSLS
ILPILYEAGRSPSHHWQLQQKLESLLGQVGEICRQDIQD
F
TQTTLDTTRSLCPQMLQTPGWRKQLEGVLVGSGGLPELLPEHLLQDAFSRL
RDMRLSITGTLAESIVAQ
A
LAGLHAARDRL
VERLTQQAPVTMAPAVPPLGGNELSPLETGGLEELFFPTEKEEEREKDESSSWKWLEP
S
NCFHLVSSLH
GAAEEAERDPELAAPGEDAEPQAGPSARGSPSPAAPGPPAGPLPRMDLPPAGQPLRHPT
R
ARPRPRRQHHHRPPPGGPQ
VPPALLQEGNGLTARVDEGVEEFFSKRLIQQDHFWAPEEDPATEGGATPV
P
RTLRKKLGTLFAFKKPRSTRGPRPDLETSPGAAARARKSTLGDLLRPPARPGRGEEPGGAEGGTSSPDP
A
RRNRPRYTRESKAYSMILLPAEEEAAVGTRPDK
RRPLERGDTELAPSFEQRVQVMLQRIGVSRASGGAE
S
KRKQ
SKDGEIKKAGSDGDIMDSSTETPPISIKSRTHSVSADPSCRPGPGGQGPESATWKTLGQQLNAEL
R
GRGWGQQDGPGPPSPCPSPSPRRTSPAPDILSLPEDPCLGPRNE
ERPLRLQRSPVLKRRPKLEAPPSPS
L
GSGLGSKPLPPYPTEPSSPERSPPSPATDQRGGGPNP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser